Diaphorina citri psyllid: psy15713

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR
ccEEEEEcccccccccccHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHcccccccccHHHccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccHHHHcccccccHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccHHHHHcccHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccHHHHHHHHcccccccccccccccHHHHHHcccHHHHHHccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccc
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVH****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S70, chain B
Confidence level:very confident
Coverage over the Query: 175-198,233-426
View the alignment between query and template
View the model in PyMOL
Template: 1S70, chain B
Confidence level:very confident
Coverage over the Query: 148-198,233-416
View the alignment between query and template
View the model in PyMOL
Template: 1YYH, chain A
Confidence level:very confident
Coverage over the Query: 200-416
View the alignment between query and template
View the model in PyMOL
Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 48-426
View the alignment between query and template
View the model in PyMOL
Template: 2HIM, chain A
Confidence level:very confident
Coverage over the Query: 1-74,113-142
View the alignment between query and template
View the model in PyMOL