Psyllid ID: psy15713

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR
ccEEEEEcccccccccccHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHcccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHcccccccccHHHccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccHHHHHccccccHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccHHHHHcccHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHcccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccc
ccEEEEEEcccccccccHHHHHHHHHHHHHccEEEEEccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHHccccccHcccccccHHHHHHHcccccHHHHHHHHHHccccHHHHHcccccHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHccccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHcHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccc
MNGVILQtygsgnfpsnRADLLELLKSANERGVIIVncsqcsrgttsniyetgksltdvgvitgydmtpesALTKLSYVLSKSdwtlekkktsltdvgvitgydmtpesALTKLSYVLSKSDWTLEKKKTIMLTNIRgeltseksteggYDLVGAVVRLLNLttekdkddlRSVLFPAMLQSAVMTGDLKRMEEIKGyvkrpqgalpfalnsslpqeitqkldidgvpslfqgadlsikdadqRSALHIACCEGHTDIVKYLLLngasvhekdRVQLTVLTNIRgeltseksteggYDLVGAVVRLLNLttekdkddlRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYefsmnphlttLISNLpqeitqkldidgvpslfqgadlsikdadqRSALHIACCEGHTDIVKYLLLngasvhekdr
MNGVILQtygsgnfpsnRADLLELLKSANERGVIIvncsqcsrgttsniyetgkslTDVGVITGYDMTPESALTKLSYVLSKSdwtlekkktsltdvgvitgydmtpesaLTKLSYVLSksdwtlekkktimltnirgeltseksteggyDLVGAVVRLLNLttekdkddlrsVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNirgeltseksteggydLVGAVVRLLNLttekdkddlrsVLFPAMlqsavmtgdlkRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLngasvhekdr
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR
****ILQTYG**NF**NRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGA*******
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVH****
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASV*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTIMLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query426 2.2.26 [Sep-21-2011]
Q9U518590 L-asparaginase OS=Dirofil N/A N/A 0.474 0.342 0.352 3e-36
Q86U10573 60 kDa lysophospholipase yes N/A 0.685 0.509 0.254 2e-23
O88202564 60 kDa lysophospholipase yes N/A 0.673 0.508 0.239 4e-19
A0JNU3564 60 kDa lysophospholipase yes N/A 0.220 0.166 0.431 4e-18
P0A962338 L-asparaginase 1 OS=Esche N/A N/A 0.185 0.233 0.469 9e-13
P0A963338 L-asparaginase 1 OS=Esche N/A N/A 0.185 0.233 0.469 9e-13
Q8U0X0438 Glutamyl-tRNA(Gln) amidot yes N/A 0.230 0.223 0.398 1e-09
Q5JI77440 Glutamyl-tRNA(Gln) amidot yes N/A 0.230 0.222 0.368 4e-09
Q8TV84458 Glutamyl-tRNA(Gln) amidot yes N/A 0.230 0.213 0.378 2e-08
Q9V0T9438 Glutamyl-tRNA(Gln) amidot yes N/A 0.230 0.223 0.368 2e-08
>sp|Q9U518|ASPG_DIRIM L-asparaginase OS=Dirofilaria immitis PE=1 SV=1 Back     alignment and function desciption
 Score =  153 bits (386), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 135/275 (49%), Gaps = 73/275 (26%)

Query: 1   MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVG 60
           + GV+LQT+G+GN PS+R D+++ LK A +RG II+NCSQC RG     Y TGK L D+G
Sbjct: 261 IEGVVLQTFGAGNMPSHRTDIIDELKKAVDRGCIIINCSQCVRGQVDIHYLTGKVLYDMG 320

Query: 61  VITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSK 120
           +I G DMT E+ALTKLSYVLSK  W                                   
Sbjct: 321 IIPGSDMTAEAALTKLSYVLSKDCW----------------------------------- 345

Query: 121 SDWTLEKKKTIMLTNIRGELTSEKSTE-GGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAM 179
               L +KK +M+ NIRGELT  K+      ++V  + R L+L++  +   L   +FP +
Sbjct: 346 ---ELVEKKAMMVKNIRGELTVAKAEPLKDLEIVSQMARFLHLSSSHEMKLLCHAIFPQL 402

Query: 180 LQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIK 239
           L  A   GD++ ++               AL+ +                   G DLS+ 
Sbjct: 403 LCYAASNGDIEMLK---------------ALHEN-------------------GVDLSVV 428

Query: 240 DADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR 274
           D + R+ALH+A   GH   VKYLL  G S H +D+
Sbjct: 429 DYNGRNALHVAASAGHVGAVKYLLTQGVSFHLRDQ 463

Dirofilaria immitis (taxid: 6287)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 1
>sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 Back     alignment and function description
>sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 Back     alignment and function description
>sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 Back     alignment and function description
>sp|P0A962|ASPG1_ECOLI L-asparaginase 1 OS=Escherichia coli (strain K12) GN=ansA PE=1 SV=1 Back     alignment and function description
>sp|P0A963|ASPG1_ECO57 L-asparaginase 1 OS=Escherichia coli O157:H7 GN=ansA PE=3 SV=1 Back     alignment and function description
>sp|Q8U0X0|GATD_PYRFU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gatD PE=3 SV=1 Back     alignment and function description
>sp|Q5JI77|GATD_PYRKO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gatD PE=3 SV=1 Back     alignment and function description
>sp|Q8TV84|GATD_METKA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=gatD PE=3 SV=1 Back     alignment and function description
>sp|Q9V0T9|GATD_PYRAB Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gatD PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
157132129 728 l-asparaginase i [Aedes aegypti] gi|1088 0.704 0.412 0.349 3e-58
170045297 699 L-asparaginase [Culex quinquefasciatus] 0.704 0.429 0.347 7e-58
347967765 692 AGAP002397-PA [Anopheles gambiae str. PE 0.488 0.300 0.427 1e-56
195477245 631 GE16877 [Drosophila yakuba] gi|194187666 0.704 0.475 0.349 8e-56
198469946 653 GA19585 [Drosophila pseudoobscura pseudo 0.704 0.459 0.349 2e-54
195163954 653 GL14545 [Drosophila persimilis] gi|19410 0.704 0.459 0.345 6e-54
322801391 659 hypothetical protein SINV_02665 [Solenop 0.730 0.471 0.354 8e-54
195046997 677 GH24648 [Drosophila grimshawi] gi|193893 0.704 0.443 0.352 1e-53
195398929 656 GJ15882 [Drosophila virilis] gi|19415049 0.488 0.317 0.430 2e-53
195456970 656 GK15547 [Drosophila willistoni] gi|19417 0.680 0.442 0.343 2e-53
>gi|157132129|ref|XP_001662477.1| l-asparaginase i [Aedes aegypti] gi|108881762|gb|EAT45987.1| AAEL002796-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  232 bits (591), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 149/426 (34%), Positives = 211/426 (49%), Gaps = 126/426 (29%)

Query: 1   MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVG 60
           M GV+LQTYG+GN P+NR DLLE L+ A  R V+IVNC+QC+ G  S++YETG+ L D+G
Sbjct: 381 MRGVVLQTYGAGNLPTNRPDLLEALRDAANREVLIVNCTQCTEGAVSDLYETGRQLQDIG 440

Query: 61  VITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSK 120
           VI G+DMTPE+AL KLSYV+SK+DW  E KK  L +                        
Sbjct: 441 VIPGFDMTPEAALVKLSYVISKADWNYETKKLMLKN------------------------ 476

Query: 121 SDWTLEKKKTIMLTNIRGELTSEKSTE-GGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAM 179
                         N+RGELT EK+ E   YDL+ AV R L L ++K+   L+S LFPAM
Sbjct: 477 --------------NLRGELTHEKTPEMQEYDLIDAVARTLQLNSDKELIQLKSSLFPAM 522

Query: 180 LQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIK 239
           + SAV+ GD+ ++  IKGY                                  GA+LS +
Sbjct: 523 VNSAVLAGDVPKINNIKGY----------------------------------GANLSAE 548

Query: 240 DADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEKSTEGGYDL 299
           + D+R+ALH+ACCEG+ ++V+YLL NGA+VH +DR   T L         +      Y+ 
Sbjct: 549 NYDRRTALHVACCEGNLEVVQYLLQNGAAVHIRDRYDRTPLM--------DAILNDHYE- 599

Query: 300 VGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVYEFSMNPHL 359
              ++RLL                  +   A +TG ++ + E                  
Sbjct: 600 ---IIRLL------------------LKCGAHLTGSIRAIGE------------------ 620

Query: 360 TTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGA 419
            +L S   + +  +L+   +     GADLS  D   R+ALH+A   G+ D+ +YL+   A
Sbjct: 621 -SLCSAAARNLLHRLESYRI----AGADLSQADPSGRTALHVAAMYGNLDVTQYLVKYYA 675

Query: 420 SVHEKD 425
            V+  D
Sbjct: 676 EVNAVD 681

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|170045297|ref|XP_001850251.1| L-asparaginase [Culex quinquefasciatus] gi|167868238|gb|EDS31621.1| L-asparaginase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347967765|ref|XP_312558.5| AGAP002397-PA [Anopheles gambiae str. PEST] gi|333468313|gb|EAA08055.5| AGAP002397-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195477245|ref|XP_002100142.1| GE16877 [Drosophila yakuba] gi|194187666|gb|EDX01250.1| GE16877 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|198469946|ref|XP_001355161.2| GA19585 [Drosophila pseudoobscura pseudoobscura] gi|198147110|gb|EAL32218.2| GA19585 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195163954|ref|XP_002022814.1| GL14545 [Drosophila persimilis] gi|194104837|gb|EDW26880.1| GL14545 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|322801391|gb|EFZ22052.1| hypothetical protein SINV_02665 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|195046997|ref|XP_001992251.1| GH24648 [Drosophila grimshawi] gi|193893092|gb|EDV91958.1| GH24648 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195398929|ref|XP_002058073.1| GJ15882 [Drosophila virilis] gi|194150497|gb|EDW66181.1| GJ15882 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195456970|ref|XP_002075368.1| GK15547 [Drosophila willistoni] gi|194171453|gb|EDW86354.1| GK15547 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
UNIPROTKB|F1NW85570 ASPG "Uncharacterized protein" 0.225 0.168 0.604 1.7e-42
FB|FBgn0029689631 CG6428 [Drosophila melanogaste 0.213 0.144 0.615 5.3e-42
ZFIN|ZDB-GENE-070820-14665 aspg "asparaginase homolog (S. 0.223 0.142 0.536 6.6e-37
WB|WBGene00007756715 C27A7.5 [Caenorhabditis elegan 0.215 0.128 0.543 1.2e-30
FB|FBgn0037759605 CG8526 [Drosophila melanogaste 0.356 0.251 0.435 1.2e-29
UNIPROTKB|Q9U518590 Q9U518 "L-asparaginase" [Dirof 0.615 0.444 0.336 5.4e-25
UNIPROTKB|G3V1Y8555 ASPG "HCG23215, isoform CRA_a" 0.246 0.189 0.449 8.8e-23
UNIPROTKB|Q86U10573 ASPG "60 kDa lysophospholipase 0.246 0.183 0.449 1e-22
UNIPROTKB|F1MGH2572 ASPG "Uncharacterized protein" 0.241 0.180 0.448 7.3e-22
RGD|708388564 Aspg "asparaginase homolog (S. 0.234 0.177 0.436 2e-21
UNIPROTKB|F1NW85 ASPG "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 313 (115.2 bits), Expect = 1.7e-42, Sum P(3) = 1.7e-42
 Identities = 58/96 (60%), Positives = 77/96 (80%)

Query:     1 MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNIYETGKSLTDVG 60
             + G++L+TYGSGN P+NR DLLE LK A ER V+I+NC+QC RG+ + +Y TG++L DVG
Sbjct:   261 IEGIVLETYGSGNAPNNREDLLEELKRATERKVVILNCTQCLRGSVTTVYATGQTLADVG 320

Query:    61 VITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTD 96
             VI GYDMTPE+ALTKLSY LSKS  + E+K+  L++
Sbjct:   321 VIPGYDMTPEAALTKLSYTLSKSKLSWEEKRQMLSE 356
GO:0004067 "asparaginase activity" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
FB|FBgn0029689 CG6428 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070820-14 aspg "asparaginase homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00007756 C27A7.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0037759 CG8526 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9U518 Q9U518 "L-asparaginase" [Dirofilaria immitis (taxid:6287)] Back     alignment and assigned GO terms
UNIPROTKB|G3V1Y8 ASPG "HCG23215, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q86U10 ASPG "60 kDa lysophospholipase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGH2 ASPG "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|708388 Aspg "asparaginase homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
PRK09461335 PRK09461, ansA, cytoplasmic asparaginase I; Provis 5e-27
smart00870323 smart00870, Asparaginase, Asparaginase, found in v 3e-23
pfam00710318 pfam00710, Asparaginase, Asparaginase 1e-22
cd08963316 cd08963, L-asparaginase_I, Type I (cytosolic) bact 3e-22
COG0252351 COG0252, AnsB, L-asparaginase/archaeal Glu-tRNAGln 1e-16
TIGR00519336 TIGR00519, asnASE_I, L-asparaginase, type I 2e-16
cd08962402 cd08962, GatD, GatD subunit of archaeal Glu-tRNA a 3e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-14
PRK04183419 PRK04183, PRK04183, glutamyl-tRNA(Gln) amidotransf 6e-13
TIGR02153404 TIGR02153, gatD_arch, glutamyl-tRNA(Gln) amidotran 3e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-09
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-07
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-07
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 8e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-07
cd08964319 cd08964, L-asparaginase_II, Type II (periplasmic) 1e-06
cd00411320 cd00411, L-asparaginase_like, Bacterial L-asparagi 1e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-05
smart0024830 smart00248, ANK, ankyrin repeats 4e-05
smart0024830 smart00248, ANK, ankyrin repeats 4e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.002
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.003
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.003
>gnl|CDD|181876 PRK09461, ansA, cytoplasmic asparaginase I; Provisional Back     alignment and domain information 
 Score =  110 bits (276), Expect = 5e-27
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 43/142 (30%)

Query: 2   NGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTSNI--YETGKSLTDV 59
             +IL++YG GN P N A LL+ LK A+ERG+++VN +QC  G   N+  Y TG +L   
Sbjct: 235 KALILRSYGVGNAPQNPA-LLQELKEASERGIVVVNLTQCMSGKV-NMGGYATGNALAHA 292

Query: 60  GVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLS 119
           GVI+G DMT E+ALTKL Y+LS+                     +++             
Sbjct: 293 GVISGADMTVEAALTKLHYLLSQ---------------------ELST------------ 319

Query: 120 KSDWTLEKKKTIMLTNIRGELT 141
                 E+ +  M  N+RGELT
Sbjct: 320 ------EEIRQAMQQNLRGELT 335

Length = 335
>gnl|CDD|214873 smart00870, Asparaginase, Asparaginase, found in various plant, animal and bacterial cells Back     alignment and domain information
>gnl|CDD|216074 pfam00710, Asparaginase, Asparaginase Back     alignment and domain information
>gnl|CDD|199207 cd08963, L-asparaginase_I, Type I (cytosolic) bacterial L-asparaginase Back     alignment and domain information
>gnl|CDD|223330 COG0252, AnsB, L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D [Amino acid transport and metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129610 TIGR00519, asnASE_I, L-asparaginase, type I Back     alignment and domain information
>gnl|CDD|199206 cd08962, GatD, GatD subunit of archaeal Glu-tRNA amidotransferase Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|235245 PRK04183, PRK04183, glutamyl-tRNA(Gln) amidotransferase subunit D; Validated Back     alignment and domain information
>gnl|CDD|233752 TIGR02153, gatD_arch, glutamyl-tRNA(Gln) amidotransferase, subunit D Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|199208 cd08964, L-asparaginase_II, Type II (periplasmic) bacterial L-asparaginase Back     alignment and domain information
>gnl|CDD|199205 cd00411, L-asparaginase_like, Bacterial L-asparaginases and related enzymes Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 426
KOG4412|consensus226 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 99.98
PHA02874 434 ankyrin repeat protein; Provisional 99.98
KOG0510|consensus 929 99.98
PHA02878 477 ankyrin repeat protein; Provisional 99.98
PHA02946446 ankyin-like protein; Provisional 99.98
PHA02876 682 ankyrin repeat protein; Provisional 99.98
KOG4412|consensus226 99.97
PHA02878 477 ankyrin repeat protein; Provisional 99.97
PHA02989 494 ankyrin repeat protein; Provisional 99.97
PHA02946 446 ankyin-like protein; Provisional 99.97
PHA02730 672 ankyrin-like protein; Provisional 99.97
KOG0509|consensus 600 99.97
PHA02798 489 ankyrin-like protein; Provisional 99.97
PHA02989 494 ankyrin repeat protein; Provisional 99.96
PHA02798 489 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG0509|consensus 600 99.96
KOG0508|consensus 615 99.96
PHA02875 413 ankyrin repeat protein; Provisional 99.96
PHA02917 661 ankyrin-like protein; Provisional 99.96
KOG0510|consensus 929 99.96
KOG4177|consensus 1143 99.95
PHA02730 672 ankyrin-like protein; Provisional 99.95
PHA02795 437 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02792 631 ankyrin-like protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.95
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.95
KOG0508|consensus 615 99.95
KOG4177|consensus 1143 99.94
KOG0502|consensus296 99.92
PHA02743166 Viral ankyrin protein; Provisional 99.92
PHA02795 437 ankyrin-like protein; Provisional 99.91
KOG0507|consensus 854 99.9
PHA02792 631 ankyrin-like protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.89
KOG0505|consensus 527 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
PHA02884 300 ankyrin repeat protein; Provisional 99.88
PHA02743166 Viral ankyrin protein; Provisional 99.87
KOG0514|consensus452 99.87
KOG0502|consensus296 99.87
KOG0512|consensus228 99.87
KOG0514|consensus452 99.86
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.86
PHA02741169 hypothetical protein; Provisional 99.86
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.85
KOG0507|consensus 854 99.85
PHA02884 300 ankyrin repeat protein; Provisional 99.84
KOG4369|consensus 2131 99.84
KOG4369|consensus 2131 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.8
KOG0505|consensus 527 99.8
KOG0195|consensus 448 99.79
KOG0512|consensus228 99.77
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.77
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.74
PRK04183419 glutamyl-tRNA(Gln) amidotransferase subunit D; Val 99.72
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.72
TIGR00519336 asnASE_I L-asparaginases, type I. Two related fami 99.72
TIGR02153404 gatD_arch glutamyl-tRNA(Gln) amidotransferase, sub 99.72
KOG3676|consensus 782 99.71
KOG0195|consensus 448 99.7
PRK09461335 ansA cytoplasmic asparaginase I; Provisional 99.7
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.64
KOG3676|consensus 782 99.59
KOG4214|consensus117 99.59
cd00411323 Asparaginase Asparaginase (amidohydrolase): Aspara 99.59
COG0252351 AnsB L-asparaginase/archaeal Glu-tRNAGln amidotran 99.55
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.55
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.54
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.52
smart00870323 Asparaginase Asparaginase, which is found in vario 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.5
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.48
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.47
PF00710313 Asparaginase: Asparaginase; InterPro: IPR006034 As 99.46
KOG0515|consensus752 99.46
KOG1710|consensus 396 99.45
KOG4214|consensus117 99.45
PRK11096347 ansB L-asparaginase II; Provisional 99.41
TIGR00520349 asnASE_II L-asparaginases, type II. Two related fa 99.41
KOG0515|consensus752 99.4
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.4
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.37
KOG0503|consensus368 99.28
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.12
PF1360630 Ank_3: Ankyrin repeat 99.12
PF1360630 Ank_3: Ankyrin repeat 99.07
KOG1710|consensus 396 99.04
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.0
KOG0506|consensus622 98.96
KOG0818|consensus 669 98.73
KOG0783|consensus 1267 98.73
KOG0783|consensus 1267 98.72
KOG0511|consensus 516 98.67
KOG0818|consensus 669 98.63
KOG0782|consensus1004 98.61
KOG0705|consensus749 98.49
KOG0506|consensus622 98.49
KOG0705|consensus749 98.47
KOG3609|consensus 822 98.4
KOG0782|consensus1004 98.38
KOG0522|consensus 560 98.37
KOG0522|consensus 560 98.29
KOG0511|consensus 516 98.21
KOG2384|consensus223 98.2
KOG0521|consensus785 98.15
KOG2384|consensus 223 98.11
KOG0521|consensus785 98.03
KOG0520|consensus 975 97.74
KOG0520|consensus 975 97.56
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.52
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.39
KOG3609|consensus 822 97.37
KOG2505|consensus591 97.14
TIGR02153404 gatD_arch glutamyl-tRNA(Gln) amidotransferase, sub 96.95
PRK04183419 glutamyl-tRNA(Gln) amidotransferase subunit D; Val 96.93
KOG2505|consensus591 96.68
PRK09461335 ansA cytoplasmic asparaginase I; Provisional 96.4
TIGR00519336 asnASE_I L-asparaginases, type I. Two related fami 96.21
smart00870323 Asparaginase Asparaginase, which is found in vario 95.98
COG0252351 AnsB L-asparaginase/archaeal Glu-tRNAGln amidotran 95.92
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.32
cd00411323 Asparaginase Asparaginase (amidohydrolase): Aspara 95.11
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.05
PF00710313 Asparaginase: Asparaginase; InterPro: IPR006034 As 93.78
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.71
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.26
TIGR00520349 asnASE_II L-asparaginases, type II. Two related fa 92.87
PRK11096347 ansB L-asparaginase II; Provisional 91.18
>KOG4412|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.2e-38  Score=253.66  Aligned_cols=169  Identities=25%  Similarity=0.251  Sum_probs=159.8

Q ss_pred             HHhhhhHHHHHHHHhcCCHHHHHHHhhhhcCCCCCcccccccCCccccccccccCCcccccCCCCCCCCCCCCCcHHHHH
Q psy15713        171 LRSVLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIA  250 (426)
Q Consensus       171 ~~~~~~~t~L~~Aa~~g~~~~v~~Ll~~~~~~~g~~~l~~a~~~~~~~~~~~~~~~~~~l~~g~~~~~~d~~g~TpLh~A  250 (426)
                      .++..++||||+||..|+.++|++|++.                                 .+..+|.+|..|+||||+|
T Consensus        33 r~dqD~Rt~LHwa~S~g~~eiv~fLlsq---------------------------------~nv~~ddkDdaGWtPlhia   79 (226)
T KOG4412|consen   33 RDDQDGRTPLHWACSFGHVEIVYFLLSQ---------------------------------PNVKPDDKDDAGWTPLHIA   79 (226)
T ss_pred             cccccCCceeeeeeecCchhHHHHHHhc---------------------------------CCCCCCCccccCCchhhhh
Confidence            4455788999999999999999999965                                 2889999999999999999


Q ss_pred             HHcCCHHHHHHHHHC-CCCCccccccCccchhc-ccccccccccccCCchhHHHHHHHhhhhcccccchhhhhhhhHHHH
Q psy15713        251 CCEGHTDIVKYLLLN-GASVHEKDRVQLTVLTN-IRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQ  328 (426)
Q Consensus       251 a~~g~~~iv~~Ll~~-ga~~~~~d~~g~tpL~~-a~~~~~~~~~~~~~~~~~~~iv~~Ll~~ga~~~~~~~~~~g~t~L~  328 (426)
                      |..|+.++|+-|+.+ |+|+|..++.|.||||+ |..+.         .+    |+++|+++|+.++.  +|..|.||||
T Consensus        80 ~s~g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r---------~e----IaqlLle~ga~i~~--kD~~~qtplH  144 (226)
T KOG4412|consen   80 ASNGNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGR---------LE----IAQLLLEKGALIRI--KDKQGQTPLH  144 (226)
T ss_pred             hhcCcHHHHHHHhcCCCCCcceecCCCcceehhhhcCCh---------hh----HHHHHHhcCCCCcc--cccccCchhH
Confidence            999999999999999 99999999999999999 88888         99    99999999999999  9999999999


Q ss_pred             HHHhhCchhHHHHHhhchhhhhhhhccCcchhHHhhcChHHHHhhhccCCcccccCCCCCCCCCCCCCcHHHHHHHcCCH
Q psy15713        329 SAVMTGDLKRMEEIKGYVSNIVYEFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHT  408 (426)
Q Consensus       329 ~A~~~g~~~~v~~L~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~L~~~~~~~l~~gad~n~~d~~g~TpL~~A~~~g~~  408 (426)
                      .|+.-|.++++++|                                       +..|+.+|.+|+.|+||||.|...|+.
T Consensus       145 RAAavGklkvie~L---------------------------------------i~~~a~~n~qDk~G~TpL~~al~e~~~  185 (226)
T KOG4412|consen  145 RAAAVGKLKVIEYL---------------------------------------ISQGAPLNTQDKYGFTPLHHALAEGHP  185 (226)
T ss_pred             HHHhccchhhHHHH---------------------------------------HhcCCCCCcccccCccHHHHHHhccCc
Confidence            99999999999999                                       888999999999999999999889999


Q ss_pred             HHHHHHHHCCCCCCCCCC
Q psy15713        409 DIVKYLLLNGASVHEKDR  426 (426)
Q Consensus       409 ~iv~~Ll~~Gad~~~~d~  426 (426)
                      ++..+|+++|||++.+|+
T Consensus       186 d~a~lLV~~gAd~~~edk  203 (226)
T KOG4412|consen  186 DVAVLLVRAGADTDREDK  203 (226)
T ss_pred             hHHHHHHHhccceeeccc
Confidence            999999999999999886

>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PRK04183 glutamyl-tRNA(Gln) amidotransferase subunit D; Validated Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>TIGR00519 asnASE_I L-asparaginases, type I Back     alignment and domain information
>TIGR02153 gatD_arch glutamyl-tRNA(Gln) amidotransferase, subunit D Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PRK09461 ansA cytoplasmic asparaginase I; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>cd00411 Asparaginase Asparaginase (amidohydrolase): Asparaginases are tetrameric enzymes that catalyze the hydrolysis of asparagine to aspartic acid and ammonia Back     alignment and domain information
>COG0252 AnsB L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D [Amino acid transport and metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>smart00870 Asparaginase Asparaginase, which is found in various plant, animal and bacterial cells, catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma PUBMED:3026924 Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF00710 Asparaginase: Asparaginase; InterPro: IPR006034 Asparaginase, which is found in various plant, animal and bacterial cells, catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma [] Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PRK11096 ansB L-asparaginase II; Provisional Back     alignment and domain information
>TIGR00520 asnASE_II L-asparaginases, type II Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0503|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>TIGR02153 gatD_arch glutamyl-tRNA(Gln) amidotransferase, subunit D Back     alignment and domain information
>PRK04183 glutamyl-tRNA(Gln) amidotransferase subunit D; Validated Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PRK09461 ansA cytoplasmic asparaginase I; Provisional Back     alignment and domain information
>TIGR00519 asnASE_I L-asparaginases, type I Back     alignment and domain information
>smart00870 Asparaginase Asparaginase, which is found in various plant, animal and bacterial cells, catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma PUBMED:3026924 Back     alignment and domain information
>COG0252 AnsB L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D [Amino acid transport and metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>cd00411 Asparaginase Asparaginase (amidohydrolase): Asparaginases are tetrameric enzymes that catalyze the hydrolysis of asparagine to aspartic acid and ammonia Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF00710 Asparaginase: Asparaginase; InterPro: IPR006034 Asparaginase, which is found in various plant, animal and bacterial cells, catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma [] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>TIGR00520 asnASE_II L-asparaginases, type II Back     alignment and domain information
>PRK11096 ansB L-asparaginase II; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
2ocd_A337 Crystal Structure Of L-Asparaginase I From Vibrio C 3e-17
3ntx_A341 Crystal Structure Of L-Asparaginase I From Yersinia 2e-15
2him_A358 Crystal Structure And Allosteric Regulation Of The 6e-14
2p2d_A358 Crystal Structure And Allosteric Regulation Of The 6e-14
1zq1_A438 Structure Of Gatde Trna-Dependent Amidotransferase 5e-09
2d6f_A435 Crystal Structure Of Glu-Trna(Gln) Amidotransferase 7e-08
1wnf_A328 Crystal Structure Of Ph0066 From Pyrococcus Horikos 2e-07
1wls_A328 Crystal Structure Of L-Asparaginase I Homologue Pro 1e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-05
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-05
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 8e-05
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 8e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-04
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-04
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-04
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-04
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-04
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-04
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-04
1uoh_A226 Human Gankyrin Length = 226 3e-04
1uoh_A 226 Human Gankyrin Length = 226 3e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-04
1qym_A 227 X-Ray Structure Of Human Gankyrin Length = 227 4e-04
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 4e-04
3aji_A 231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 4e-04
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-04
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-04
>pdb|2OCD|A Chain A, Crystal Structure Of L-Asparaginase I From Vibrio Cholerae O1 Biovar Eltor Str. N16961 Length = 337 Back     alignment and structure 
Iteration: 1

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
Query: 1   MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRGTTS-NIYETGKSLTDV 59
           +N  IL T+G GN P N  +LL  LK+A+ERGVI+VN +QC  G  +   Y TG +L D 
Sbjct: 235 VNAXILLTFGVGNAPQN-PELLAQLKAASERGVIVVNLTQCLAGKVNXGGYATGCALADA 293
Query: 60  GVITGYDMTPESALTKLSYVLSKS 83
           GVI+GYD TPE+AL KL Y+LS++
Sbjct: 294 GVISGYDXTPEAALAKLHYLLSQN 317
>pdb|3NTX|A Chain A, Crystal Structure Of L-Asparaginase I From Yersinia Pestis Length = 341 Back     alignment and structure
>pdb|2HIM|A Chain A, Crystal Structure And Allosteric Regulation Of The Cytoplasmic Escherichia Coli L-Asparaginase I Length = 358 Back     alignment and structure
>pdb|2P2D|A Chain A, Crystal Structure And Allosteric Regulation Of The Cytoplasmic Escherichia Coli L-Asparaginase I Length = 358 Back     alignment and structure
>pdb|1ZQ1|A Chain A, Structure Of Gatde Trna-Dependent Amidotransferase From Pyrococcus Abyssi Length = 438 Back     alignment and structure
>pdb|2D6F|A Chain A, Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The Complex With Trna(Gln) Length = 435 Back     alignment and structure
>pdb|1WNF|A Chain A, Crystal Structure Of Ph0066 From Pyrococcus Horikoshii Length = 328 Back     alignment and structure
>pdb|1WLS|A Chain A, Crystal Structure Of L-Asparaginase I Homologue Protein From Pyrococcus Horikoshii Length = 328 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
1wls_A328 L-asparaginase; structural genomics, hydrolase; 2. 8e-34
2him_A358 L-asparaginase 1; hydrolase; 1.82A {Escherichia co 3e-31
1zq1_A438 Glutamyl-tRNA(Gln) amidotransferase subunit D; X-R 3e-31
2d6f_A435 Glutamyl-tRNA(Gln) amidotransferase subunit D; lig 2e-30
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-11
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 3e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-21
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-11
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-09
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-09
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-07
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-21
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 7e-20
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-09
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-21
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-20
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-11
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-07
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-19
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-06
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-10
1bi7_B 156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-11
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-11
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-11
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-19
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-17
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-17
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-18
2etb_A 256 Transient receptor potential cation channel subfam 2e-10
2etb_A256 Transient receptor potential cation channel subfam 2e-08
2etb_A256 Transient receptor potential cation channel subfam 2e-08
2pnn_A273 Transient receptor potential cation channel subfa 1e-17
2pnn_A 273 Transient receptor potential cation channel subfa 2e-09
2pnn_A273 Transient receptor potential cation channel subfa 4e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-17
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-07
2rfa_A232 Transient receptor potential cation channel subfa 3e-17
2rfa_A232 Transient receptor potential cation channel subfa 1e-15
2rfa_A 232 Transient receptor potential cation channel subfa 3e-09
2rfa_A232 Transient receptor potential cation channel subfa 2e-05
2rfa_A 232 Transient receptor potential cation channel subfa 1e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-07
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-16
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-08
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-10
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-08
1wsa_A330 Asparaginase, asparagine amidohydrolase; periplasm 4e-15
1nns_A326 L-asparaginase II; amidrohydrolase, crystallograph 8e-15
3nxk_A334 Cytoplasmic L-asparaginase; structural genomics, c 1e-14
2wlt_A332 L-asparaginase; hydrolase; 1.40A {Helicobacter pyl 4e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-14
3jxi_A 260 Vanilloid receptor-related osmotically activated p 1e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-04
3jxi_A 260 Vanilloid receptor-related osmotically activated p 5e-04
1agx_A331 Glutaminase-asparaginase; bacterial amidohydrolase 3e-13
4pga_A337 Glutaminase-asparaginase; bacterial amidohydrolase 4e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-08
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-12
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-10
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-09
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-07
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-07
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 3e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-12
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-10
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-08
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-08
1o7j_A327 L-asparaginase; atomic resolution, hydrolase; 1.0A 5e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-11
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 6e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-08
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-08
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 7e-07
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 7e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-06
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-06
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-11
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-11
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-10
2y1l_E 169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-05
1awc_B 153 Protein (GA binding protein beta 1); complex (tran 2e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
3v30_A 172 DNA-binding protein rfxank; structural genomics co 2e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-05
3v30_A 172 DNA-binding protein rfxank; structural genomics co 2e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-11
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 7e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-05
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 1e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-06
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 1e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-05
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 5e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-11
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-09
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 3e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-06
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-04
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 5e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-11
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-09
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-07
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-09
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 3e-09
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 4e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-07
3twr_A 165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-09
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-09
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-05
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-09
2rfm_A 192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-05
>1wls_A L-asparaginase; structural genomics, hydrolase; 2.16A {Pyrococcus horikoshii} PDB: 1wnf_A Length = 328 Back     alignment and structure
 Score =  128 bits (323), Expect = 8e-34
 Identities = 34/142 (23%), Positives = 54/142 (38%), Gaps = 41/142 (28%)

Query: 1   MNGVILQTYGSGNFPSNRADLLELLKSANERGVIIVNCSQCSRG-TTSNIYETGKSLTDV 59
             G+IL+ YG G  P    DL E++  +  + + +V  +Q          Y+ G+   + 
Sbjct: 224 YKGIILEGYGVGGIPYRGTDLFEVVS-SISKRIPVVLTTQAIYDGVDLQRYKVGRIALEA 282

Query: 60  GVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLS 119
           GVI   DMT E+ +TKL ++L  +                                    
Sbjct: 283 GVIPAGDMTKEATITKLMWILGHT------------------------------------ 306

Query: 120 KSDWTLEKKKTIMLTNIRGELT 141
                +E+ K +M  NI GELT
Sbjct: 307 ---KNIEEVKQLMGKNITGELT 325
>2him_A L-asparaginase 1; hydrolase; 1.82A {Escherichia coli} PDB: 2p2d_A 2p2n_A 3ntx_A* 2ocd_A Length = 358 Back     alignment and structure
>1zq1_A Glutamyl-tRNA(Gln) amidotransferase subunit D; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: b.38.3.1 c.88.1.1 Length = 438 Back     alignment and structure
>2d6f_A Glutamyl-tRNA(Gln) amidotransferase subunit D; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: b.38.3.1 c.88.1.1 Length = 435 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1wsa_A Asparaginase, asparagine amidohydrolase; periplasmic; 2.20A {Wolinella succinogenes} SCOP: c.88.1.1 Length = 330 Back     alignment and structure
>1nns_A L-asparaginase II; amidrohydrolase, crystallographic comparison hydrolase; 1.95A {Escherichia coli} SCOP: c.88.1.1 PDB: 3eca_A 1ho3_A 1jaz_A 1ihd_A 1jja_A 4eca_A* Length = 326 Back     alignment and structure
>3nxk_A Cytoplasmic L-asparaginase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; 2.40A {Campylobacter jejuni subsp} Length = 334 Back     alignment and structure
>2wlt_A L-asparaginase; hydrolase; 1.40A {Helicobacter pylori} PDB: 2wt4_A Length = 332 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1agx_A Glutaminase-asparaginase; bacterial amidohydrolase; 2.90A {Acinetobacter glutaminasificans} SCOP: c.88.1.1 Length = 331 Back     alignment and structure
>4pga_A Glutaminase-asparaginase; bacterial amidohydrolase; 1.70A {Pseudomonas SP} SCOP: c.88.1.1 PDB: 1djp_A* 1djo_A* 3pga_1 Length = 337 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1o7j_A L-asparaginase; atomic resolution, hydrolase; 1.0A {Erwinia chrysanthemi} SCOP: c.88.1.1 PDB: 1hfj_A 1hfk_A* 1hg0_A 1hg1_A 1hfw_A* 1jsr_A* 1jsl_A 2gvn_A 1zcf_A 2hln_A* 2jk0_A Length = 327 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2pnn_A273 Transient receptor potential cation channel subfa 99.98
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.98
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.98
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.98
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.98
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.98
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.98
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
2pnn_A273 Transient receptor potential cation channel subfa 99.95
3hra_A201 Ankyrin repeat family protein; structural protein; 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.85
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.82
2him_A358 L-asparaginase 1; hydrolase; 1.82A {Escherichia co 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.74
1wls_A328 L-asparaginase; structural genomics, hydrolase; 2. 99.73
1zq1_A438 Glutamyl-tRNA(Gln) amidotransferase subunit D; X-R 99.72
2d6f_A435 Glutamyl-tRNA(Gln) amidotransferase subunit D; lig 99.71
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.71
4pga_A337 Glutaminase-asparaginase; bacterial amidohydrolase 99.59
1nns_A326 L-asparaginase II; amidrohydrolase, crystallograph 99.58
1wsa_A330 Asparaginase, asparagine amidohydrolase; periplasm 99.58
1agx_A331 Glutaminase-asparaginase; bacterial amidohydrolase 99.57
3nxk_A334 Cytoplasmic L-asparaginase; structural genomics, c 99.56
2wlt_A332 L-asparaginase; hydrolase; 1.40A {Helicobacter pyl 99.55
1o7j_A327 L-asparaginase; atomic resolution, hydrolase; 1.0A 99.42
2him_A358 L-asparaginase 1; hydrolase; 1.82A {Escherichia co 96.74
2d6f_A435 Glutamyl-tRNA(Gln) amidotransferase subunit D; lig 96.66
1zq1_A438 Glutamyl-tRNA(Gln) amidotransferase subunit D; X-R 96.65
1wls_A328 L-asparaginase; structural genomics, hydrolase; 2. 96.33
1nns_A326 L-asparaginase II; amidrohydrolase, crystallograph 95.09
1wsa_A330 Asparaginase, asparagine amidohydrolase; periplasm 95.0
4pga_A337 Glutaminase-asparaginase; bacterial amidohydrolase 94.78
1agx_A331 Glutaminase-asparaginase; bacterial amidohydrolase 94.49
2wlt_A332 L-asparaginase; hydrolase; 1.40A {Helicobacter pyl 93.73
3nxk_A334 Cytoplasmic L-asparaginase; structural genomics, c 92.6
1o7j_A327 L-asparaginase; atomic resolution, hydrolase; 1.0A 91.07
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=4.6e-39  Score=314.66  Aligned_cols=336  Identities=18%  Similarity=0.098  Sum_probs=264.1

Q ss_pred             hHHHhhHHHHHcCcccCCCCCHHHHHHHHHHHhcCCCcchhhhhhhhhhcccccccCCChhhHHHHHHHHhcCCccCHHH
Q psy15713         48 NIYETGKSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEKKKTSLTDVGVITGYDMTPESALTKLSYVLSKSDWTLEK  127 (426)
Q Consensus        48 ~~~~~~~~l~~~g~~~~~d~t~e~~~~~l~~~~~~~~l~~~~~~~~~~~~~~i~~~~~~~~~~~~~l~~~l~~~~~~~~~  127 (426)
                      +..+.++.|++.|.-+  +.......++|+++...+++.+.+.-...   +.  ..+.......++|+++...+  ..+.
T Consensus        25 g~~~~v~~Ll~~g~~~--~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~---g~--~~~~~~~~g~t~L~~A~~~g--~~~~   95 (437)
T 1n11_A           25 GHLPIVKNLLQRGASP--NVSNVKVETPLHMAARAGHTEVAKYLLQN---KA--KVNAKAKDDQTPLHCAARIG--HTNM   95 (437)
T ss_dssp             TCHHHHHHHHHTTCCS--CCSSSCCCCHHHHHHHHTCHHHHHHHHHH---TC--CSSCCCTTSCCHHHHHHHHT--CHHH
T ss_pred             CCHHHHHHHHHcCCCC--CCCCCCCCCHHHHHHHcCCHHHHHHHHhC---CC--CCCCCCCCCCCHHHHHHHCC--CHHH
Confidence            4456788888888532  22222345678888888877765532221   00  01112233445888888764  5777


Q ss_pred             HHHHhccccc-------ccccccccCC-CCCchhHHHHhhhccCChhhHHhHHhhhhHHHHHHHHhcCCHHHHHHHhhhh
Q psy15713        128 KKTIMLTNIR-------GELTSEKSTE-GGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYV  199 (426)
Q Consensus       128 v~~~~~~~~~-------~~~~~~~~~~-g~~~~v~~l~~~l~~~~~~~~~~~~~~~~~t~L~~Aa~~g~~~~v~~Ll~~~  199 (426)
                      ++.+++....       +......++. |+.++++.+++......      ..+..+.||||+|+..|+.+++++|+++.
T Consensus        96 v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~------~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g  169 (437)
T 1n11_A           96 VKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQA------CMTKKGFTPLHVAAKYGKVRVAELLLERD  169 (437)
T ss_dssp             HHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSC------CCCTTSCCHHHHHHHTTCHHHHHHHHHTT
T ss_pred             HHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCc------CCCCCCCCHHHHHHHcCCHHHHHHHHhCC
Confidence            7777765332       2222333333 88888888877642211      12345669999999999999999999983


Q ss_pred             -----cCCCCCcccccccCCccccccccccCCcccccCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCccccc
Q psy15713        200 -----KRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR  274 (426)
Q Consensus       200 -----~~~~g~~~l~~a~~~~~~~~~~~~~~~~~~l~~g~~~~~~d~~g~TpLh~Aa~~g~~~iv~~Ll~~ga~~~~~d~  274 (426)
                           .+..|.||+++|+..++..+.+.++      ..|++++..+..|.||||+|+..|+.+++++|+++|++++..+.
T Consensus       170 ~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll------~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~  243 (437)
T 1n11_A          170 AHPNAAGKNGLTPLHVAVHHNNLDIVKLLL------PRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESV  243 (437)
T ss_dssp             CCTTCCCSSCCCHHHHHHHTTCHHHHHHHG------GGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT
T ss_pred             CCCCCCCCCCCCHHHHHHHcCCHHHHHHHH------hCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCC
Confidence                 3457899999999999865555543      34899999999999999999999999999999999999999999


Q ss_pred             cCccchhc-ccccccccccccCCchhHHHHHHHhhhhcccccchhhhhhhhHHHHHHHhhCchhHHHHHhhchhhhh-hh
Q psy15713        275 VQLTVLTN-IRGELTSEKSTEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIV-YE  352 (426)
Q Consensus       275 ~g~tpL~~-a~~~~~~~~~~~~~~~~~~~iv~~Ll~~ga~~~~~~~~~~g~t~L~~A~~~g~~~~v~~L~~~~~~~~-~~  352 (426)
                      .|.||||+ +..++         .+    ++++|+++|++++.  .+..|.||||+|+..|+.+++++|++++.+++ .+
T Consensus       244 ~g~t~L~~A~~~g~---------~~----~v~~Ll~~~~~~~~--~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~  308 (437)
T 1n11_A          244 QGVTPLHLAAQEGH---------AE----MVALLLSKQANGNL--GNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATT  308 (437)
T ss_dssp             TCCCHHHHHHHTTC---------HH----HHHHHHTTTCCTTC--CCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCC
T ss_pred             CCCCHHHHHHHCCC---------HH----HHHHHHhcCCCCCC--CCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCC
Confidence            99999999 88888         89    99999999999988  89999999999999999999999999988877 44


Q ss_pred             hccCcchhHHhhcChHHHHhhhccCCcccccCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCC
Q psy15713        353 FSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDR  426 (426)
Q Consensus       353 ~~~~~~l~~~~~~~~~~~~~~L~~~~~~~l~~gad~n~~d~~g~TpL~~A~~~g~~~iv~~Ll~~Gad~~~~d~  426 (426)
                      ..+.++++.|+..++.+++++|       +++|+++|.+|..|+||||+|+.+|+.++|++|+++|||++.+|+
T Consensus       309 ~~g~t~L~~A~~~g~~~~v~~L-------l~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~  375 (437)
T 1n11_A          309 RMGYTPLHVASHYGNIKLVKFL-------LQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS  375 (437)
T ss_dssp             SSCCCHHHHHHHSSCSHHHHHH-------HHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCS
T ss_pred             CCCCCHHHHHHHcCcHHHHHHH-------HhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCC
Confidence            5677899999999999999999       999999999999999999999999999999999999999998874
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2him_A L-asparaginase 1; hydrolase; 1.82A {Escherichia coli} PDB: 2p2d_A 2p2n_A 3ntx_A* 2ocd_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1wls_A L-asparaginase; structural genomics, hydrolase; 2.16A {Pyrococcus horikoshii} PDB: 1wnf_A Back     alignment and structure
>1zq1_A Glutamyl-tRNA(Gln) amidotransferase subunit D; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: b.38.3.1 c.88.1.1 Back     alignment and structure
>2d6f_A Glutamyl-tRNA(Gln) amidotransferase subunit D; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: b.38.3.1 c.88.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4pga_A Glutaminase-asparaginase; bacterial amidohydrolase; 1.70A {Pseudomonas SP} SCOP: c.88.1.1 PDB: 1djp_A* 1djo_A* 3pga_1 Back     alignment and structure
>1nns_A L-asparaginase II; amidrohydrolase, crystallographic comparison hydrolase; 1.95A {Escherichia coli} SCOP: c.88.1.1 PDB: 3eca_A 1ho3_A 1jaz_A 1ihd_A 1jja_A 4eca_A* Back     alignment and structure
>1wsa_A Asparaginase, asparagine amidohydrolase; periplasmic; 2.20A {Wolinella succinogenes} SCOP: c.88.1.1 Back     alignment and structure
>1agx_A Glutaminase-asparaginase; bacterial amidohydrolase; 2.90A {Acinetobacter glutaminasificans} SCOP: c.88.1.1 Back     alignment and structure
>3nxk_A Cytoplasmic L-asparaginase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; 2.40A {Campylobacter jejuni subsp} Back     alignment and structure
>2wlt_A L-asparaginase; hydrolase; 1.40A {Helicobacter pylori} PDB: 2wt4_A Back     alignment and structure
>1o7j_A L-asparaginase; atomic resolution, hydrolase; 1.0A {Erwinia chrysanthemi} SCOP: c.88.1.1 PDB: 1hfj_A 1hfk_A* 1hg0_A 1hg1_A 1hfw_A* 1jsr_A* 1jsl_A 2gvn_A 1zcf_A 2hln_A* 2jk0_A Back     alignment and structure
>2him_A L-asparaginase 1; hydrolase; 1.82A {Escherichia coli} PDB: 2p2d_A 2p2n_A 3ntx_A* 2ocd_A Back     alignment and structure
>2d6f_A Glutamyl-tRNA(Gln) amidotransferase subunit D; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: b.38.3.1 c.88.1.1 Back     alignment and structure
>1zq1_A Glutamyl-tRNA(Gln) amidotransferase subunit D; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: b.38.3.1 c.88.1.1 Back     alignment and structure
>1wls_A L-asparaginase; structural genomics, hydrolase; 2.16A {Pyrococcus horikoshii} PDB: 1wnf_A Back     alignment and structure
>1nns_A L-asparaginase II; amidrohydrolase, crystallographic comparison hydrolase; 1.95A {Escherichia coli} SCOP: c.88.1.1 PDB: 3eca_A 1ho3_A 1jaz_A 1ihd_A 1jja_A 4eca_A* Back     alignment and structure
>1wsa_A Asparaginase, asparagine amidohydrolase; periplasmic; 2.20A {Wolinella succinogenes} SCOP: c.88.1.1 Back     alignment and structure
>4pga_A Glutaminase-asparaginase; bacterial amidohydrolase; 1.70A {Pseudomonas SP} SCOP: c.88.1.1 PDB: 1djp_A* 1djo_A* 3pga_1 Back     alignment and structure
>1agx_A Glutaminase-asparaginase; bacterial amidohydrolase; 2.90A {Acinetobacter glutaminasificans} SCOP: c.88.1.1 Back     alignment and structure
>2wlt_A L-asparaginase; hydrolase; 1.40A {Helicobacter pylori} PDB: 2wt4_A Back     alignment and structure
>3nxk_A Cytoplasmic L-asparaginase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; 2.40A {Campylobacter jejuni subsp} Back     alignment and structure
>1o7j_A L-asparaginase; atomic resolution, hydrolase; 1.0A {Erwinia chrysanthemi} SCOP: c.88.1.1 PDB: 1hfj_A 1hfk_A* 1hg0_A 1hg1_A 1hfw_A* 1jsr_A* 1jsl_A 2gvn_A 1zcf_A 2hln_A* 2jk0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 426
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-20
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-16
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-07
d2d6fa2352 c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransf 2e-19
d1zq1a2363 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransf 2e-19
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-19
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-09
d2ocda1336 c.88.1.1 (A:2-337) Asparaginase type II {Vibrio ch 1e-17
d1nnsa_326 c.88.1.1 (A:) Asparaginase type II {Escherichia co 4e-17
d1wsaa_328 c.88.1.1 (A:) Asparaginase type II {Wolinella succ 7e-17
d4pgaa_330 c.88.1.1 (A:) Glutaminase-asparaginase {Pseudomona 3e-16
d1agxa_331 c.88.1.1 (A:) Glutaminase-asparaginase {Acinetobac 3e-16
d1o7ja_325 c.88.1.1 (A:) Asparaginase type II {Erwinia chrysa 6e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-10
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-13
d1ihba_ 156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-10
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-07
d1bd8a_ 156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-06
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1awcb_ 153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 6e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 7e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 7e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 90.8 bits (224), Expect = 1e-20
 Identities = 41/195 (21%), Positives = 69/195 (35%), Gaps = 20/195 (10%)

Query: 232 QGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGASVHEKDRVQLTVLTNIRGELTSEK 291
           +GA  ++ +    + LH+A   GHT++ KYLL N A V+ K +   T L           
Sbjct: 22  RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPL---------HC 72

Query: 292 STEGGYDLVGAVVRLLNLTTEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIVY 351
           +   G+     +V+LL            +   P  + +     +       K      + 
Sbjct: 73  AARIGHT---NMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMT 129

Query: 352 EFSMNPHLTTLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIV 411
           +    P L          + + L       L + A  +    +  + LH+A    + DIV
Sbjct: 130 KKGFTP-LHVAAKYGKVRVAELL-------LERDAHPNAAGKNGLTPLHVAVHHNNLDIV 181

Query: 412 KYLLLNGASVHEKDR 426
           K LL  G S H    
Sbjct: 182 KLLLPRGGSPHSPAW 196
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2d6fa2 c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 352 Back     information, alignment and structure
>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Length = 363 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ocda1 c.88.1.1 (A:2-337) Asparaginase type II {Vibrio cholerae [TaxId: 666]} Length = 336 Back     information, alignment and structure
>d1nnsa_ c.88.1.1 (A:) Asparaginase type II {Escherichia coli [TaxId: 562]} Length = 326 Back     information, alignment and structure
>d1wsaa_ c.88.1.1 (A:) Asparaginase type II {Wolinella succinogenes [TaxId: 844]} Length = 328 Back     information, alignment and structure
>d4pgaa_ c.88.1.1 (A:) Glutaminase-asparaginase {Pseudomonas sp., 7A [TaxId: 306]} Length = 330 Back     information, alignment and structure
>d1agxa_ c.88.1.1 (A:) Glutaminase-asparaginase {Acinetobacter glutaminasificans [TaxId: 474]} Length = 331 Back     information, alignment and structure
>d1o7ja_ c.88.1.1 (A:) Asparaginase type II {Erwinia chrysanthemi [TaxId: 556]} Length = 325 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.93
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.93
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.86
d1zq1a2363 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 99.75
d2ocda1336 Asparaginase type II {Vibrio cholerae [TaxId: 666] 99.74
d2d6fa2352 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 99.73
d1nnsa_326 Asparaginase type II {Escherichia coli [TaxId: 562 99.54
d1wsaa_328 Asparaginase type II {Wolinella succinogenes [TaxI 99.52
d4pgaa_330 Glutaminase-asparaginase {Pseudomonas sp., 7A [Tax 99.52
d1o7ja_325 Asparaginase type II {Erwinia chrysanthemi [TaxId: 99.49
d1agxa_331 Glutaminase-asparaginase {Acinetobacter glutaminas 99.48
d2d6fa2352 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 96.46
d2ocda1336 Asparaginase type II {Vibrio cholerae [TaxId: 666] 96.16
d1zq1a2363 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 95.97
d4pgaa_330 Glutaminase-asparaginase {Pseudomonas sp., 7A [Tax 93.87
d1wsaa_328 Asparaginase type II {Wolinella succinogenes [TaxI 92.93
d1nnsa_326 Asparaginase type II {Escherichia coli [TaxId: 562 90.31
d1agxa_331 Glutaminase-asparaginase {Acinetobacter glutaminas 89.32
d1o7ja_325 Asparaginase type II {Erwinia chrysanthemi [TaxId: 84.61
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=1e-35  Score=267.25  Aligned_cols=191  Identities=19%  Similarity=0.146  Sum_probs=166.7

Q ss_pred             hhhHHHHHHHHhcCCHHHHHHHhhhhcCCCCCcccccccCCccccccccccCCcccccCCCC---CCCCCCCCCcHHHHH
Q psy15713        174 VLFPAMLQSAVMTGDLKRMEEIKGYVKRPQGALPFALNSSLPQEITQKLDIDGVPSLFQGAD---LSIKDADQRSALHIA  250 (426)
Q Consensus       174 ~~~~t~L~~Aa~~g~~~~v~~Ll~~~~~~~g~~~l~~a~~~~~~~~~~~~~~~~~~l~~g~~---~~~~d~~g~TpLh~A  250 (426)
                      +.|.||||+||+.|+.+++++|+++                                  |++   ++.+|..|+||||+|
T Consensus         7 ~~G~t~Lh~A~~~~~~~~v~~Ll~~----------------------------------~a~~~~i~~~~~~g~TpL~~A   52 (255)
T d1oy3d_           7 EDGDTALHLAVIHQHEPFLDFLLGF----------------------------------SAGHEYLDLQNDLGQTALHLA   52 (255)
T ss_dssp             TTCCCHHHHHHHTTCHHHHHHHHHH----------------------------------HTTSGGGGCCCTTSCCHHHHH
T ss_pred             cCCCCHHHHHHHcCCHHHHHHHHHc----------------------------------CCCcccccCcCCCCCCccchH
Confidence            4567999999999999999999999                                  776   667788899999999


Q ss_pred             HHcCCHHHHHHHHHCCCCCccccccCccchhc-ccccccccccccCCchhHHHHHHHhhhh-------------------
Q psy15713        251 CCEGHTDIVKYLLLNGASVHEKDRVQLTVLTN-IRGELTSEKSTEGGYDLVGAVVRLLNLT-------------------  310 (426)
Q Consensus       251 a~~g~~~iv~~Ll~~ga~~~~~d~~g~tpL~~-a~~~~~~~~~~~~~~~~~~~iv~~Ll~~-------------------  310 (426)
                      |..|+.+++++|+++|++++.+|.+|.||||+ +..++         .+    ++++|++.                   
T Consensus        53 ~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~A~~~~~---------~~----~~~~Ll~~~~~~~~~~~~~~~~~~~~~  119 (255)
T d1oy3d_          53 AILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRA---------HT----CACVLLQPRPSHPRDASDTYLTQSQDC  119 (255)
T ss_dssp             HHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHHHTTTTC---------HH----HHHHHSSSCCSSCCCC-----------
T ss_pred             HhhcccccccccccccccccccccccchhhhhhhccCc---------hH----HHHHHHhhccchhcccchhhhhHHhhh
Confidence            99999999999999999999999999999999 66666         44    44444332                   


Q ss_pred             ----------------------------cccccchhhhhhhhHHHHHHHhhCchhHHHHHhhchhhhh--hhhccCcchh
Q psy15713        311 ----------------------------TEKDKDDLRSVLFPAMLQSAVMTGDLKRMEEIKGYVSNIV--YEFSMNPHLT  360 (426)
Q Consensus       311 ----------------------------ga~~~~~~~~~~g~t~L~~A~~~g~~~~v~~L~~~~~~~~--~~~~~~~~l~  360 (426)
                                                  +.+++.  ++..|.||||+|+..++.+++++|++.+.+..  ....+.++++
T Consensus       120 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~--~d~~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~  197 (255)
T d1oy3d_         120 TPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEA--ENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLH  197 (255)
T ss_dssp             ------------------------CCCGGGGTTC--CCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHH
T ss_pred             cccchHHHHHHHhhcchhHHHHHHhhhcCccccc--ccccCcccccccccccccccccchhccccccccccccccccccc
Confidence                                        233333  67789999999999999999999999888776  3456778999


Q ss_pred             HHhhcChHHHHhhhccCCcccccCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHCCCC
Q psy15713        361 TLISNLPQEITQKLDIDGVPSLFQGADLSIKDADQRSALHIACCEGHTDIVKYLLLNGAS  420 (426)
Q Consensus       361 ~~~~~~~~~~~~~L~~~~~~~l~~gad~n~~d~~g~TpL~~A~~~g~~~iv~~Ll~~Gad  420 (426)
                      .|+..++.+++++|       +++|+|+|.+|..|+||||+|+.+++.+++++|+++||+
T Consensus       198 ~A~~~~~~~~v~~L-------l~~gadin~~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga~  250 (255)
T d1oy3d_         198 LAVEAQAASVLELL-------LKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAP  250 (255)
T ss_dssp             HHHHTTCHHHHHHH-------HHTTCCTTCCCTTSCCHHHHHHTSSCHHHHHHHHHTTCC
T ss_pred             ccccccHHHHHHHH-------HHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHcCCC
Confidence            99999999999999       999999999999999999999999999999999999997
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2ocda1 c.88.1.1 (A:2-337) Asparaginase type II {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2d6fa2 c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nnsa_ c.88.1.1 (A:) Asparaginase type II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wsaa_ c.88.1.1 (A:) Asparaginase type II {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d4pgaa_ c.88.1.1 (A:) Glutaminase-asparaginase {Pseudomonas sp., 7A [TaxId: 306]} Back     information, alignment and structure
>d1o7ja_ c.88.1.1 (A:) Asparaginase type II {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1agxa_ c.88.1.1 (A:) Glutaminase-asparaginase {Acinetobacter glutaminasificans [TaxId: 474]} Back     information, alignment and structure
>d2d6fa2 c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ocda1 c.88.1.1 (A:2-337) Asparaginase type II {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d4pgaa_ c.88.1.1 (A:) Glutaminase-asparaginase {Pseudomonas sp., 7A [TaxId: 306]} Back     information, alignment and structure
>d1wsaa_ c.88.1.1 (A:) Asparaginase type II {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nnsa_ c.88.1.1 (A:) Asparaginase type II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1agxa_ c.88.1.1 (A:) Glutaminase-asparaginase {Acinetobacter glutaminasificans [TaxId: 474]} Back     information, alignment and structure
>d1o7ja_ c.88.1.1 (A:) Asparaginase type II {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure