Diaphorina citri psyllid: psy1572


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MQISGLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKSK
ccccccccccHHHHHHccccccHHHcccccEEEEEEEccccEEEECcccccHHHHHHHHHHHHHHHHHHHHccc
****GLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQ**KTVAAHNAIEYLRLMTK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQISGLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070918 [BP]production of small RNA involved in gene silencing by RNAprobableGO:0009892, GO:0019222, GO:0090304, GO:0031050, GO:0010629, GO:0006807, GO:0070887, GO:0050789, GO:0044699, GO:0006139, GO:0051716, GO:0010605, GO:0044260, GO:0071359, GO:1901360, GO:0016458, GO:0071704, GO:0071310, GO:0065007, GO:0014070, GO:0048519, GO:0046483, GO:0010468, GO:0060255, GO:0009987, GO:0006725, GO:0044763, GO:0031047, GO:0008152, GO:0042221, GO:0010033, GO:0010467, GO:0016070, GO:0044238, GO:0071407, GO:1901698, GO:1901699, GO:0034641, GO:0044237, GO:0043170, GO:0043331, GO:0008150, GO:0050896, GO:0006396
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0010586 [BP]miRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0034660, GO:1901360, GO:0046483
GO:0070920 [BP]regulation of production of small RNA involved in gene silencing by RNAprobableGO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051252, GO:0048583, GO:0050789, GO:0060966, GO:0065007, GO:0051171, GO:0008150, GO:0050794, GO:0010468, GO:0060968

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DIX, chain A
Confidence level:confident
Coverage over the Query: 28-71
View the alignment between query and template
View the model in PyMOL
Template: 2F4L, chain A
Confidence level:probable
Coverage over the Query: 3-25,36-68
View the alignment between query and template
View the model in PyMOL