Psyllid ID: psy1572

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70----
MQISGLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKSK
ccccccccccHHHHHHccccccHHHcccccEEEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHccc
cccccccccEEEEEEccccccEEEEcccccEEEEEEEccccEEEEccccccHHHHHHHHHHHHHHHHHHHHccc
mqisglldTRVCLISTNGSNSIAFLHSTGQFQALVQLATypvavchgqgktqQEAKTVAAHNAIEYLRLMTKSK
MQISGLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKSK
MQISGLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKSK
*****LLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRL*****
****G***TRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQ**K*VAAHNAIEYLRLMTK**
MQISGLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHG*********TVAAHNAIEYLRLMTKSK
****GLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQISGLLDTRVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query74 2.2.26 [Sep-21-2011]
Q2HJ92313 Interferon-inducible doub yes N/A 0.729 0.172 0.425 2e-07
Q9WTX2313 Interferon-inducible doub yes N/A 0.729 0.172 0.425 4e-07
Q4V8C7313 Interferon-inducible doub yes N/A 0.729 0.172 0.425 4e-07
O75569313 Interferon-inducible doub yes N/A 0.729 0.172 0.425 4e-07
Q91836298 Interferon-inducible doub N/A N/A 0.675 0.167 0.46 2e-06
Q7ZYA5309 Interferon-inducible doub N/A N/A 0.675 0.161 0.46 2e-06
P97473365 RISC-loading complex subu no N/A 0.945 0.191 0.367 5e-06
>sp|Q2HJ92|PRKRA_BOVIN Interferon-inducible double stranded RNA-dependent protein kinase activator A OS=Bos taurus GN=PRKRA PE=2 SV=1 Back     alignment and function desciption
 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 37/54 (68%)

Query: 21  SIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKSK 74
            I  L + GQ+Q L +L+T P+ VCHG G +   A++ AAHNA++YL+++ + K
Sbjct: 260 DIEELSANGQYQCLAELSTSPITVCHGSGISCSSAQSDAAHNALQYLKIIAERK 313
Activates EIF2AK2/PKR in the absence of double stranded RNA (dsRNA), leading to phosphorylation of EIF2S1/EFI2-alpha and inhibition of translation and induction of apoptosis. Required for siRNA production by DICER1 and for subsequent siRNA-mediated post-transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by DICER1.
Bos taurus (taxid: 9913)
>sp|Q9WTX2|PRKRA_MOUSE Interferon-inducible double stranded RNA-dependent protein kinase activator A OS=Mus musculus GN=Prkra PE=1 SV=1 Back     alignment and function description
>sp|Q4V8C7|PRKRA_RAT Interferon-inducible double stranded RNA-dependent protein kinase activator A OS=Rattus norvegicus GN=Prkra PE=1 SV=1 Back     alignment and function description
>sp|O75569|PRKRA_HUMAN Interferon-inducible double stranded RNA-dependent protein kinase activator A OS=Homo sapiens GN=PRKRA PE=1 SV=1 Back     alignment and function description
>sp|Q91836|PRKAB_XENLA Interferon-inducible double stranded RNA-dependent protein kinase activator A homolog B OS=Xenopus laevis GN=prkra-b PE=1 SV=1 Back     alignment and function description
>sp|Q7ZYA5|PRKAA_XENLA Interferon-inducible double stranded RNA-dependent protein kinase activator A homolog A OS=Xenopus laevis GN=prkra-a PE=2 SV=1 Back     alignment and function description
>sp|P97473|TRBP2_MOUSE RISC-loading complex subunit TARBP2 OS=Mus musculus GN=Tarbp2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
157119564 329 tar RNA binding protein (trbp) [Aedes ae 0.621 0.139 0.630 4e-10
425626950 353 loquacious [Mayetiola destructor] 0.621 0.130 0.673 2e-09
195156001 470 GL26052 [Drosophila persimilis] gi|19411 0.608 0.095 0.666 2e-09
198477035153 GA22530 [Drosophila pseudoobscura pseudo 0.608 0.294 0.666 3e-09
198476324 477 GA19915 [Drosophila pseudoobscura pseudo 0.608 0.094 0.666 3e-09
375161472 339 tar RNA binding protein-like protein [La 0.608 0.132 0.666 4e-09
312385229158 hypothetical protein AND_01016 [Anophele 0.621 0.291 0.608 4e-09
158298694 341 AGAP009781-PA [Anopheles gambiae str. PE 0.608 0.131 0.622 7e-09
195398117 481 GJ17975 [Drosophila virilis] gi|19414132 0.608 0.093 0.644 8e-09
221328528 323 TAR RNA-binding protein 2 isoform 2 [Fen 0.689 0.157 0.588 8e-09
>gi|157119564|ref|XP_001659426.1| tar RNA binding protein (trbp) [Aedes aegypti] gi|108875294|gb|EAT39519.1| AAEL008687-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score = 68.6 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 39/46 (84%)

Query: 28  TGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKS 73
           +G+FQ LVQL+T PVAVCHG G T +EA+T AA N++EYL++MTK+
Sbjct: 284 SGRFQCLVQLSTLPVAVCHGSGSTAKEAQTAAARNSLEYLKIMTKT 329

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|425626950|gb|AFX89033.1| loquacious [Mayetiola destructor] Back     alignment and taxonomy information
>gi|195156001|ref|XP_002018889.1| GL26052 [Drosophila persimilis] gi|194115042|gb|EDW37085.1| GL26052 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198477035|ref|XP_002136790.1| GA22530 [Drosophila pseudoobscura pseudoobscura] gi|198145112|gb|EDY71816.1| GA22530 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|198476324|ref|XP_001357331.2| GA19915 [Drosophila pseudoobscura pseudoobscura] gi|198137644|gb|EAL34400.2| GA19915 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|375161472|gb|AFA41504.1| tar RNA binding protein-like protein [Laodelphax striatella] Back     alignment and taxonomy information
>gi|312385229|gb|EFR29781.1| hypothetical protein AND_01016 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158298694|ref|XP_318876.4| AGAP009781-PA [Anopheles gambiae str. PEST] gi|157014008|gb|EAA14308.5| AGAP009781-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195398117|ref|XP_002057671.1| GJ17975 [Drosophila virilis] gi|194141325|gb|EDW57744.1| GJ17975 [Drosophila virilis] Back     alignment and taxonomy information
>gi|221328528|gb|ACM17807.1| TAR RNA-binding protein 2 isoform 2 [Fenneropenaeus chinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
FB|FBgn0032515465 loqs "loquacious" [Drosophila 0.608 0.096 0.622 9.5e-10
ZFIN|ZDB-GENE-050309-206289 prkra "protein kinase, interfe 0.608 0.155 0.543 2.5e-08
UNIPROTKB|B4DJC7200 PRKRA "cDNA FLJ60590, highly s 0.675 0.25 0.44 2.6e-08
UNIPROTKB|Q2HJ92313 PRKRA "Interferon-inducible do 0.675 0.159 0.44 6.5e-08
UNIPROTKB|J9P4M2313 PRKRA "Uncharacterized protein 0.675 0.159 0.44 1.1e-07
UNIPROTKB|O75569313 PRKRA "Interferon-inducible do 0.675 0.159 0.44 1.1e-07
UNIPROTKB|F1RZE0313 PRKRA "Uncharacterized protein 0.675 0.159 0.44 1.1e-07
MGI|MGI:1344375313 Prkra "protein kinase, interfe 0.675 0.159 0.44 1.1e-07
RGD|1306707313 Prkra "protein kinase, interfe 0.675 0.159 0.44 1.1e-07
UNIPROTKB|Q4V8C7313 Prkra "Interferon-inducible do 0.675 0.159 0.44 1.1e-07
FB|FBgn0032515 loqs "loquacious" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 149 (57.5 bits), Expect = 9.5e-10, P = 9.5e-10
 Identities = 28/45 (62%), Positives = 35/45 (77%)

Query:    28 TGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTK 72
             +GQFQ LVQL+T PV VCHG G T  +A+  AA NA+EYL++MTK
Sbjct:   420 SGQFQCLVQLSTLPVGVCHGSGPTAADAQRHAAQNALEYLKIMTK 464
GO:0003725 "double-stranded RNA binding" evidence=ISS
GO:0031054 "pre-miRNA processing" evidence=IDA;IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0030718 "germ-line stem cell maintenance" evidence=IMP
GO:0048132 "female germ-line stem cell division" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0030422 "production of siRNA involved in RNA interference" evidence=IDA;IMP
GO:0007417 "central nervous system development" evidence=IMP
GO:0070918 "production of small RNA involved in gene silencing by RNA" evidence=IDA
GO:0010586 "miRNA metabolic process" evidence=IDA
GO:0070920 "regulation of production of small RNA involved in gene silencing by RNA" evidence=IDA
GO:0016442 "RNA-induced silencing complex" evidence=IPI
ZFIN|ZDB-GENE-050309-206 prkra "protein kinase, interferon-inducible double stranded RNA dependent activator" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4DJC7 PRKRA "cDNA FLJ60590, highly similar to Interferon-inducible double strandedRNA-dependent protein kinase activator A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJ92 PRKRA "Interferon-inducible double stranded RNA-dependent protein kinase activator A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P4M2 PRKRA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75569 PRKRA "Interferon-inducible double stranded RNA-dependent protein kinase activator A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZE0 PRKRA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1344375 Prkra "protein kinase, interferon inducible double stranded RNA dependent activator" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306707 Prkra "protein kinase, interferon inducible double stranded RNA dependent activator" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V8C7 Prkra "Interferon-inducible double stranded RNA-dependent protein kinase activator A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 74
KOG3732|consensus339 99.48
PF0003567 dsrm: Double-stranded RNA binding motif; InterPro: 97.98
smart0035867 DSRM Double-stranded RNA binding motif. 97.67
cd0004868 DSRM Double-stranded RNA binding motif. Binding is 97.39
PRK00102229 rnc ribonuclease III; Reviewed 95.87
TIGR02191220 RNaseIII ribonuclease III, bacterial. This family 94.95
PHA03103183 double-strand RNA-binding protein; Provisional 94.09
PRK12371235 ribonuclease III; Reviewed 93.67
PHA02701183 ORF020 dsRNA-binding PKR inhibitor; Provisional 93.33
PF1470980 DND1_DSRM: double strand RNA binding domain from D 93.06
PF0336890 Dicer_dimer: Dicer dimerisation domain; InterPro: 91.82
PRK12372 413 ribonuclease III; Reviewed 90.15
PRK14718 467 ribonuclease III; Provisional 87.54
COG0571235 Rnc dsRNA-specific ribonuclease [Transcription] 87.5
KOG3732|consensus 339 86.79
PF14954 252 LIX1: Limb expression 1 86.01
>KOG3732|consensus Back     alignment and domain information 
Probab=99.48  E-value=3.3e-15  Score=116.96  Aligned_cols=54  Identities=48%  Similarity=0.697  Sum_probs=51.2

Q ss_pred             ceeeeccccceeEEEEeccCCceEeecCCCCHHHHHHHHHHHHHHHHHHhhcCC
Q psy1572          21 SIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTKSK   74 (74)
Q Consensus        21 ~ieels~~G~yqcLV~LST~P~~VCHGsG~S~~eA~~~AA~NALqyLkiM~~~k   74 (74)
                      .|++.|++|++||+|++||.|++||||+++|+..|+.+||++||+||+||.+.+
T Consensus       286 d~~~~t~sg~~~~~~e~s~~~~~~~~~s~~t~~~s~~~aa~~~L~yL~~~~~f~  339 (339)
T KOG3732|consen  286 DIEELTLSGQNQCLVELSTSPATVCHGSSITPPSAQSEAAHNALEYLKIMAGFK  339 (339)
T ss_pred             hhHHhhhhhHHHHHHHhcCCCceeeeccCCCCCcccchhHHHHHHHHHHHhcCC
Confidence            368899999999999999999999999999999999999999999999999764

>PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] Back     alignment and domain information
>smart00358 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>cd00048 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PRK00102 rnc ribonuclease III; Reviewed Back     alignment and domain information
>TIGR02191 RNaseIII ribonuclease III, bacterial Back     alignment and domain information
>PHA03103 double-strand RNA-binding protein; Provisional Back     alignment and domain information
>PRK12371 ribonuclease III; Reviewed Back     alignment and domain information
>PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional Back     alignment and domain information
>PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 Back     alignment and domain information
>PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases Back     alignment and domain information
>PRK12372 ribonuclease III; Reviewed Back     alignment and domain information
>PRK14718 ribonuclease III; Provisional Back     alignment and domain information
>COG0571 Rnc dsRNA-specific ribonuclease [Transcription] Back     alignment and domain information
>KOG3732|consensus Back     alignment and domain information
>PF14954 LIX1: Limb expression 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
1di2_A69 XLRBPA, double stranded RNA binding protein A; pro 97.27
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 96.97
2b7v_A71 Double-stranded RNA-specific editase 1; RNA editin 96.95
3adl_A88 RISC-loading complex subunit tarbp2; TRBP2, miRNA 96.85
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 96.84
2dix_A84 Interferon-inducible double stranded RNA- dependen 96.82
3llh_A90 RISC-loading complex subunit tarbp2; DSRBD, DSRM, 96.76
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 96.74
2cpn_A89 TAR RNA-binding protein 2; double-stranded RNA bin 96.73
1x48_A88 Interferon-induced, double-stranded RNA- activated 96.72
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 96.66
1ekz_A76 DSRBDIII, maternal effect protein (staufen); struc 96.6
3p1x_A75 Interleukin enhancer-binding factor 3; structural 96.54
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 96.33
1t4n_A94 Ribonuclease III; DSRBD, RNA-binding, hydrolase; N 96.32
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 96.19
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 96.15
1uil_A113 Double-stranded RNA-binding motif; structural geno 95.93
1whq_A99 RNA helicase A; double-stranded RNA binding domain 95.86
2nug_A221 Ribonuclease III, RNAse III; dsRNA, RNA interferen 95.85
1whn_A128 Hypothetical protein riken cDNA 2310016K04; double 95.82
1x49_A97 Interferon-induced, double-stranded RNA- activated 95.8
2l33_A91 Interleukin enhancer-binding factor 3; structural 95.75
3c4b_A265 Endoribonuclease dicer; RNAse, dsRNA binding prote 95.66
1t4o_A117 Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro 95.62
2dmy_A97 Spermatid perinuclear RNA-binding protein; DSRM do 95.62
2khx_A85 Ribonuclease 3; drosha, RNA binding domain, hydrol 95.47
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 95.32
2ljh_A114 Double-stranded RNA-specific editase ADAR; DSRBD, 95.28
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 95.27
1o0w_A252 Ribonuclease III, RNAse III; TM1102, structural ge 94.94
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 94.86
2yt4_A 232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 94.45
2l3j_A 236 Double-stranded RNA-specific editase 1; editing, d 93.47
3rv0_A341 K. polysporus DCR1; RNAse III enzyme, RNA binding 92.53
3n3w_A248 Ribonuclease III; nuclease domain, ribonuclase III 92.39
2a11_A242 Ribonuclease III, RNAse III; nuclease domain, stru 92.03
2f4l_A297 Acetamidase, putative; structural genomics, joint 84.34
3mjj_A301 Predicted acetamidase/formamidase; beta/alpha stru 81.24
2kou_A102 Dicer-like protein 4; ATP-binding, endonuclease, h 81.08
>1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Back     alignment and structure
Probab=97.27  E-value=0.00069  Score=39.48  Aligned_cols=39  Identities=28%  Similarity=0.409  Sum_probs=32.9

Q ss_pred             cccceeEEEEeccCCceEeecCCCCHHHHHHHHHHHHHHHHH
Q psy1572          27 STGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLR   68 (74)
Q Consensus        27 ~~G~yqcLV~LST~P~~VCHGsG~S~~eA~~~AA~NALqyLk   68 (74)
                      .+-.|.|-|.+.-  . +..|.|.|-.+|..+||+.||+.|+
T Consensus        30 h~~~F~~~v~v~~--~-~~~G~G~sKK~Aeq~AA~~al~~L~   68 (69)
T 1di2_A           30 HKREFTITCRVET--F-VETGSGTSKQVAKRVAAEKLLTKFK   68 (69)
T ss_dssp             GGCEEEEEEEETT--E-EEEEEESSHHHHHHHHHHHHHHHHH
T ss_pred             CCCeEEEEEEECC--E-EEEeecCCHHHHHHHHHHHHHHHHh
Confidence            3456878888765  4 8899999999999999999999885
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Back     alignment and structure
>2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Back     alignment and structure
>3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Back     alignment and structure
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Back     alignment and structure
>2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Back     alignment and structure
>2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Back     alignment and structure
>3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Back     alignment and structure
>1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Back     alignment and structure
>1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Back     alignment and structure
>2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Back     alignment and structure
>1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Back     alignment and structure
>3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Back     alignment and structure
>1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B Back     alignment and structure
>2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Back     alignment and structure
>3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Back     alignment and structure
>2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2f4l_A Acetamidase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 2.50A {Thermotoga maritima} SCOP: b.23.3.1 Back     alignment and structure
>2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
d1t4oa_81 RNase III, C-terminal domain {Baker's yeast (Sacch 97.37
d1di2a_69 Double-stranded RNA-binding protein A, second dsRB 97.24
d2dixa173 Interferon-inducible double stranded RNA-dependent 97.08
d2nuga268 RNase III, C-terminal domain {Aquifex aeolicus [Ta 97.03
d2dmya184 Spermatid perinuclear RNA-binding protein {Human ( 96.96
d2b7ta173 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 96.93
d2b7va171 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 96.91
d1o0wa269 RNase III, C-terminal domain {Thermotoga maritima 96.91
d1x47a185 Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} 96.86
d1whqa_99 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 96.72
d1ekza_76 Staufen, domain III {Fruit fly (Drosophila melanog 96.52
d1qu6a289 dsRNA-dependent protein kinase pkr {Human (Homo sa 96.44
d1qu6a190 dsRNA-dependent protein kinase pkr {Human (Homo sa 96.4
d1x48a176 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 96.39
d1x49a185 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 96.36
d1uila_113 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 96.22
d2cpna176 TAR RNA-binding protein 2 {Human (Homo sapiens) [T 95.9
d1uhza_89 staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 95.79
d1whna_128 tRNA-dihydrouridine synthase 2-like, Dus2l (231001 93.9
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: dsRBD-like
superfamily: dsRNA-binding domain-like
family: Double-stranded RNA-binding domain (dsRBD)
domain: RNase III, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.37  E-value=0.00031  Score=41.28  Aligned_cols=55  Identities=13%  Similarity=0.080  Sum_probs=38.4

Q ss_pred             eEEeeeCCCCCceeeeccccceeEEEEeccCCceEeecCCCCHHHHHHHHHHHHHHHHHHhhc
Q psy1572          10 RVCLISTNGSNSIAFLHSTGQFQALVQLATYPVAVCHGQGKTQQEAKTVAAHNAIEYLRLMTK   72 (74)
Q Consensus        10 ~v~~~~~~~~n~ieels~~G~yqcLV~LST~P~~VCHGsG~S~~eA~~~AA~NALqyLkiM~~   72 (74)
                      .-.+++..+.+|-.       |.+-+.+. .-..+..|.|.|..+|..+||++||+.+++|.+
T Consensus        24 ~Y~~~~~~~~~~~~-------f~v~~~v~-~~~~~~~g~g~SKK~AEq~AA~~aL~~~~~l~k   78 (81)
T d1t4oa_          24 HYVTVKKPTAVDPN-------SIVECRVG-DGTVLGTGVGRNIKIAGIRAAENALRDKKMLDF   78 (81)
T ss_dssp             EEEEEECCCSSCCC-------EEEEEECT-TCCEEEEEEESSHHHHHHHHHHHHHHCHHHHHH
T ss_pred             EEEEeccCCCCCCC-------EEEEEEEe-cCceEEecccchhhHHHHHHHHHHHHhccHHHH
Confidence            33445555555543       33333333 234568899999999999999999999999864
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure