Diaphorina citri psyllid: psy15738

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MFADSRPESTFWIFGKPITRIMFADLAIMFADSRPESTFWIFGKLITSCSYIILATSLLHYLSYILAMEKEEEERKKKKKRKKRKKKKKKKEKRIPPRIIYVSGAGKVEVKKGYSVTLECKADGNPVPNITWTRKNNNLPGGEYSYSGNSLTVRHTNRHSAGIYLCVANNMVGSSAAASIALHVLCK
cCECccccCEEEECcccEEEEEEEEEEEEccccccCEEEEEEcEEEccccEEEEEEcccccEEEEEEEEEEEEEEEEEEccccccEEEEEEEEEcccCEEECccccEEEEEccccEEEEEEEEEEcccEEEEEEcccccccccCEECccEEEEccccccccEEEEEEEEcccccccEEEEEEEEEEc
*******ESTFWIFGKPITRIMFADLAIMFADSRPESTFWIFGKLITSCSYIILATSLLHYLSYILAMEKEEEE**************KKKEKRIPPRIIYVSGAGKVEVKKGYSVTLECKADGNPVPNITWTRKNNNLPGGEYSYSGNSLTVRHTNRHSAGIYLCVANNMVGSSAAASIALHVLCK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFADSRPESTFWIFGKPITRIMFADLAIMFADSRPESTFWIFGKLITSCSYIILATSLLHYLSYILAxxxxxxxxxxxxxxxxxxxxxxxxxxRIPPRIIYVSGAGKVEVKKGYSVTLECKADGNPVPNITWTRKNNNLPGGEYSYSGNSLTVRHTNRHSAGIYLCVANNMVGSSAAASIALHVLCK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0048666 [BP]neuron developmentprobableGO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0043227 [CC]membrane-bounded organelleprobableGO:0005575, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0044304 [CC]main axonprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0010035 [BP]response to inorganic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0007156 [BP]homophilic cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YD1, chain A
Confidence level:very confident
Coverage over the Query: 27-186
View the alignment between query and template
View the model in PyMOL
Template: 4FA8, chain A
Confidence level:confident
Coverage over the Query: 2-32,46-176
View the alignment between query and template
View the model in PyMOL