Diaphorina citri psyllid: psy15742


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MESKKVLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLNTLPSEFGSQRKKKRRRKKRSFELNYQEDLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMFSPSQDMETV
ccHHHHHHHHHcHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccccccccHHHccccHHHHHHHHHccccccccccCEccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccEEEEEccHHHHcccccccEEEEcccccccccccccccccccccccccHHHHHHHHHHcccccEEEccccccHHHHHHHccccccCEEEccccccccccccccc
*****VLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLN***************************DLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMFSP*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESKKVLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLNTLPSEFGSQRKKKRRRKKRSFELNYQEDLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMFSPSQDMETV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trimethylguanosine synthase Catalyzes the two serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylates the m3G cap on TLC1 telomerase which affects telomere silencing and telomere length regulation. Required for pre-mRNA splicing, pre-rRNA processing and small ribosomal subunit synthesis. Involved in nucleolar structural organization.confidentQ12052

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0036261 [BP]7-methylguanosine cap hypermethylationprobableGO:0036260, GO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0032259, GO:0009987, GO:0006725, GO:0043412, GO:0043414, GO:0008152, GO:0001510, GO:0046483, GO:0016070, GO:0044238, GO:0044237, GO:0043170, GO:0008150, GO:0006396
GO:0071164 [MF]RNA trimethylguanosine synthase activityprobableGO:0003824, GO:0008173, GO:0016740, GO:0016741, GO:0003674, GO:0008168
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GDH, chain A
Confidence level:very confident
Coverage over the Query: 110-163,187-324
View the alignment between query and template
View the model in PyMOL
Template: 1UWV, chain A
Confidence level:confident
Coverage over the Query: 170-269,289-342
View the alignment between query and template
View the model in PyMOL