Psyllid ID: psy15742


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MESKKVLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLNTLPSEFGSQRKKKRRRKKRSFELNYQEDLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMFSPSQDMETV
ccHHHHHHHHHcHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccHHHccccHHHHHHHHHccccccccccEEccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHcccccEEEEEccHHHHcccccccEEEEcccccccccccccccccccccccccHHHHHHHHHHcccccEEEccccccHHHHHHHHcccccEEEEccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHccccHHHHHHccccccccccccHHHHHHHHHHHccccHHHHHcHccccHHHcccHHHHHHHHHHHHHHHHcccccEEcccccccccHHHHHHHHHHHHHHccccccccEEccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccHHHHHHHccccEEEEccccccccccccccccHHHHcccccHHHHHHHHHHHcccEEEEccccccHHHHHHHccccccccEEEEEEcccccccEccc
MESKKVLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQetlntlpsefgsqrkkkrrrkkrSFELNYqedlgdlenvpeeiwanpylnkyYQQRYLYWSRydegilmdeeswysvtPEKVAQHIASRCkasdvvidgwysvtPEKVAQHIASRCkasdvvidgfcgcggnTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQgdffalapslqgdvvflsppwggpeyarssfsidnifpeqgggrRLFQVARgispnvgyylprtsdVFEIFhdsgkkgsfisltgrqmfspsqdmetv
meskkvleDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQetlntlpsefgsqrkkkrrrkkrsfelnyqedlgdlenvpeeiwANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFisltgrqmfspsqdmetv
MESKKVLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLNTLPSEFGSQrkkkrrrkkrSFELNYQEDLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMFSPSQDMETV
******LEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLN***************************DLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFI*****************
*****V***VAYQDI******************************************************************************************DLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMFSP***M***
MESKKVLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLNTLPSE**************SFELNYQEDLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMF*********
**SKKVLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLN*LPS****Q*********RSFELNYQEDLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMFSPS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESKKVLEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQDILITYKLSTLSGCAQKVLFNILEDVAYQETLNTLPSEFGSQRKKKRRRKKRSFELNYQEDLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSFISLTGRQMFSPSQDMETV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query342 2.2.26 [Sep-21-2011]
P85107850 Trimethylguanosine syntha yes N/A 0.549 0.221 0.45 2e-48
Q923W1853 Trimethylguanosine syntha yes N/A 0.543 0.218 0.449 5e-48
Q96RS0853 Trimethylguanosine syntha yes N/A 0.540 0.216 0.456 3e-47
Q09814239 Trimethylguanosine syntha yes N/A 0.558 0.799 0.422 5e-36
Q12052315 Trimethylguanosine syntha yes N/A 0.605 0.657 0.308 4e-20
Q2RFW1283 Release factor glutamine yes N/A 0.260 0.314 0.290 4e-05
Q7NGN4457 Uncharacterized RNA methy yes N/A 0.228 0.170 0.303 0.0001
P39199310 50S ribosomal protein L3 N/A N/A 0.350 0.387 0.276 0.0002
P0A293310 50S ribosomal protein L3 yes N/A 0.260 0.287 0.282 0.0002
P0A294310 50S ribosomal protein L3 N/A N/A 0.260 0.287 0.282 0.0002
>sp|P85107|TGS1_RAT Trimethylguanosine synthase OS=Rattus norvegicus GN=Tgs1 PE=1 SV=1 Back     alignment and function desciption
 Score =  192 bits (489), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 139/220 (63%), Gaps = 32/220 (14%)

Query: 107 LENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDV 166
           +  +P EI + P L KY+ QRY  +SR+D+GI +D+E                       
Sbjct: 625 INGLPPEIASVPELAKYWAQRYRLFSRFDDGIKLDKE----------------------- 661

Query: 167 VIDGWYSVTPEKVAQHIASRCKAS---DVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAK 223
              GW+SVTPEK+A+HIA R   S   D+++D FCG GGNTIQFA   ++VI+IDIDP K
Sbjct: 662 ---GWFSVTPEKIAEHIAGRVSQSFNCDIIVDAFCGVGGNTIQFALTGKRVIAIDIDPVK 718

Query: 224 LRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARS-SFSIDNIFP 282
           + LA++NA VYGV+ KI+FI GDF  LAP L+ DVVFLSPPWGGP+YA + +F I  +  
Sbjct: 719 IDLARNNAEVYGVADKIEFICGDFLLLAPCLKADVVFLSPPWGGPDYATAETFDIRTMM- 777

Query: 283 EQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKG 322
               G  +F++++ I+ N+ Y+LPR +DV ++   +G  G
Sbjct: 778 -SPDGFEIFRLSQKITNNIVYFLPRNADVDQVASLAGPGG 816




Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q923W1|TGS1_MOUSE Trimethylguanosine synthase OS=Mus musculus GN=Tgs1 PE=1 SV=2 Back     alignment and function description
>sp|Q96RS0|TGS1_HUMAN Trimethylguanosine synthase OS=Homo sapiens GN=TGS1 PE=1 SV=3 Back     alignment and function description
>sp|Q09814|TGS1_SCHPO Trimethylguanosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tgs1 PE=1 SV=3 Back     alignment and function description
>sp|Q12052|TGS1_YEAST Trimethylguanosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGS1 PE=1 SV=1 Back     alignment and function description
>sp|Q2RFW1|PRMC_MOOTA Release factor glutamine methyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=prmC PE=3 SV=1 Back     alignment and function description
>sp|Q7NGN4|Y3134_GLOVI Uncharacterized RNA methyltransferase gll3134 OS=Gloeobacter violaceus (strain PCC 7421) GN=gll3134 PE=3 SV=1 Back     alignment and function description
>sp|P39199|PRMB_ECOLI 50S ribosomal protein L3 glutamine methyltransferase OS=Escherichia coli (strain K12) GN=prmB PE=1 SV=3 Back     alignment and function description
>sp|P0A293|PRMB_SALTY 50S ribosomal protein L3 glutamine methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prmB PE=3 SV=1 Back     alignment and function description
>sp|P0A294|PRMB_SALTI 50S ribosomal protein L3 glutamine methyltransferase OS=Salmonella typhi GN=prmB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
384485281407 hypothetical protein RO3G_02165 [Rhizopu 0.5 0.420 0.492 3e-53
320167535 522 Tgs1 protein [Capsaspora owczarzaki ATCC 0.616 0.404 0.438 7e-51
193662159248 PREDICTED: trimethylguanosine synthase-l 0.578 0.798 0.429 7e-51
156548692 577 PREDICTED: hypothetical protein LOC10011 0.576 0.341 0.467 9e-51
198435713 787 PREDICTED: similar to hepatocellular car 0.511 0.222 0.490 9e-51
307213126 978 Trimethylguanosine synthase-like protein 0.561 0.196 0.464 1e-50
350410802 1112 PREDICTED: hypothetical protein LOC10074 0.517 0.159 0.490 1e-49
383862993 1113 PREDICTED: uncharacterized protein LOC10 0.517 0.159 0.470 2e-49
332031558 1035 Trimethylguanosine synthase [Acromyrmex 0.520 0.171 0.473 3e-49
196009009 725 hypothetical protein TRIADDRAFT_58107 [T 0.540 0.255 0.469 1e-48
>gi|384485281|gb|EIE77461.1| hypothetical protein RO3G_02165 [Rhizopus delemar RA 99-880] Back     alignment and taxonomy information
 Score =  215 bits (547), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 134/201 (66%), Gaps = 30/201 (14%)

Query: 120 LNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKV 179
           + KYY QRY Y+S++DEG+LMD+E                          GW+SVTPEK+
Sbjct: 179 MKKYYFQRYEYFSKFDEGVLMDKE--------------------------GWFSVTPEKI 212

Query: 180 AQHIASRCKASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHK 239
           A HI+ RC+ SDV+ID FCGCGGN+IQFA  C +VI+ID+DP KL  A+ NA +YGV HK
Sbjct: 213 ASHISKRCQ-SDVIIDAFCGCGGNSIQFALSCNQVIAIDLDPVKLYCARENAKIYGVEHK 271

Query: 240 IQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARS-SFSIDNIFPEQGGGRRLFQVARGIS 298
           I+FI GDFF LAP L+ DVVFLSPPWGGP Y  + +F++ ++ P  G    +FQ+A  I+
Sbjct: 272 IEFILGDFFQLAPKLKADVVFLSPPWGGPSYMNTETFNLKSMIPRDGA--HIFQIASSIT 329

Query: 299 PNVGYYLPRTSDVFEIFHDSG 319
           PN+ Y++PR +D  ++   +G
Sbjct: 330 PNIAYFVPRNTDPHQLARLAG 350




Source: Rhizopus delemar RA 99-880

Species: Rhizopus delemar

Genus: Rhizopus

Family: Rhizopodaceae

Order: Mucorales

Class:

Phylum:

Superkingdom: Eukaryota

>gi|320167535|gb|EFW44434.1| Tgs1 protein [Capsaspora owczarzaki ATCC 30864] Back     alignment and taxonomy information
>gi|193662159|ref|XP_001950779.1| PREDICTED: trimethylguanosine synthase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|156548692|ref|XP_001602591.1| PREDICTED: hypothetical protein LOC100118684 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|198435713|ref|XP_002131256.1| PREDICTED: similar to hepatocellular carcinoma-associated antigen 137 [Ciona intestinalis] Back     alignment and taxonomy information
>gi|307213126|gb|EFN88648.1| Trimethylguanosine synthase-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350410802|ref|XP_003489145.1| PREDICTED: hypothetical protein LOC100748607 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383862993|ref|XP_003706967.1| PREDICTED: uncharacterized protein LOC100882090 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332031558|gb|EGI71030.1| Trimethylguanosine synthase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|196009009|ref|XP_002114370.1| hypothetical protein TRIADDRAFT_58107 [Trichoplax adhaerens] gi|190583389|gb|EDV23460.1| hypothetical protein TRIADDRAFT_58107 [Trichoplax adhaerens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
RGD|1309953850 Tgs1 "trimethylguanosine synth 0.444 0.178 0.518 5.5e-43
ZFIN|ZDB-GENE-070802-2800 tgs1 "trimethylguanosine synth 0.444 0.19 0.525 8.8e-43
MGI|MGI:2151797853 Tgs1 "trimethylguanosine synth 0.444 0.178 0.512 2e-42
UNIPROTKB|Q96RS0853 TGS1 "Trimethylguanosine synth 0.444 0.178 0.512 6.8e-42
UNIPROTKB|I3LL53842 LOC100621800 "Uncharacterized 0.447 0.181 0.531 6.9e-42
UNIPROTKB|F1RT52852 TGS1 "Uncharacterized protein" 0.447 0.179 0.531 7.5e-42
UNIPROTKB|E1C5P9 434 TGS1 "Uncharacterized protein" 0.307 0.241 0.495 1.3e-25
UNIPROTKB|F1N1K9854 TGS1 "Uncharacterized protein" 0.447 0.179 0.493 3e-38
UNIPROTKB|E2RCA5853 TGS1 "Uncharacterized protein" 0.447 0.179 0.506 5.3e-38
UNIPROTKB|F1NL90853 TGS1 "Uncharacterized protein" 0.423 0.169 0.486 8.7e-38
RGD|1309953 Tgs1 "trimethylguanosine synthase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 426 (155.0 bits), Expect = 5.5e-43, Sum P(2) = 5.5e-43
 Identities = 82/158 (51%), Positives = 114/158 (72%)

Query:   169 DGWYSVTPEKVAQHIASRCKAS---DVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLR 225
             +GW+SVTPEK+A+HIA R   S   D+++D FCG GGNTIQFA   ++VI+IDIDP K+ 
Sbjct:   661 EGWFSVTPEKIAEHIAGRVSQSFNCDIIVDAFCGVGGNTIQFALTGKRVIAIDIDPVKID 720

Query:   226 LAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARS-SFSIDNIFPEQ 284
             LA++NA VYGV+ KI+FI GDF  LAP L+ DVVFLSPPWGGP+YA + +F I  +    
Sbjct:   721 LARNNAEVYGVADKIEFICGDFLLLAPCLKADVVFLSPPWGGPDYATAETFDIRTMMSPD 780

Query:   285 GGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKG 322
             G    +F++++ I+ N+ Y+LPR +DV ++   +G  G
Sbjct:   781 GF--EIFRLSQKITNNIVYFLPRNADVDQVASLAGPGG 816


GO:0001510 "RNA methylation" evidence=ISO
GO:0005634 "nucleus" evidence=IEA;ISO
GO:0005737 "cytoplasm" evidence=IEA;ISO
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0009452 "7-methylguanosine RNA capping" evidence=IEA
GO:0036261 "7-methylguanosine cap hypermethylation" evidence=ISO
GO:0071164 "RNA trimethylguanosine synthase activity" evidence=IEA;ISO
ZFIN|ZDB-GENE-070802-2 tgs1 "trimethylguanosine synthase homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2151797 Tgs1 "trimethylguanosine synthase homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96RS0 TGS1 "Trimethylguanosine synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LL53 LOC100621800 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RT52 TGS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5P9 TGS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1K9 TGS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCA5 TGS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NL90 TGS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q12052TGS1_YEAST2, ., 1, ., 1, ., -0.30830.60520.6571yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
pfam09445165 pfam09445, Methyltransf_15, RNA cap guanine-N2 met 5e-43
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 2e-11
pfam01170172 pfam01170, UPF0020, Putative RNA methylase family 3e-09
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 3e-08
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 1e-07
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases re 2e-06
COG2890280 COG2890, HemK, Methylase of polypeptide chain rele 3e-06
COG1092393 COG1092, COG1092, Predicted SAM-dependent methyltr 4e-06
COG0116381 COG0116, COG0116, Predicted N6-adenine-specific DN 1e-05
TIGR00536284 TIGR00536, hemK_fam, HemK family putative methylas 2e-05
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 2e-05
COG2520341 COG2520, COG2520, Predicted methyltransferase [Gen 3e-05
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 3e-05
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 3e-05
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 6e-05
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth 1e-04
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 2e-04
TIGR00479431 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransf 4e-04
pfam02475199 pfam02475, Met_10, Met-10+ like-protein 7e-04
TIGR00537179 TIGR00537, hemK_rel_arch, HemK-related putative me 0.001
PTZ00338 294 PTZ00338, PTZ00338, dimethyladenosine transferase- 0.001
PRK11783 702 PRK11783, rlmL, 23S rRNA m(2)G2445 methyltransfera 0.001
TIGR02021219 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-m 0.002
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 0.002
TIGR03533284 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) m 0.003
TIGR01177329 TIGR01177, TIGR01177, TIGR01177 family protein 0.003
>gnl|CDD|220246 pfam09445, Methyltransf_15, RNA cap guanine-N2 methyltransferase Back     alignment and domain information
 Score =  146 bits (370), Expect = 5e-43
 Identities = 61/129 (47%), Positives = 81/129 (62%), Gaps = 7/129 (5%)

Query: 192 VVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALA 251
           +++D FCG GGNTIQFA V   VI IDI+P  L  AQHNA VYGVS +I FI GD+F L 
Sbjct: 3   IILDVFCGAGGNTIQFANVFCSVIGIDINPEHLACAQHNAEVYGVSDRIWFILGDWFELL 62

Query: 252 PSLQG-----DVVFLSPPWGGPEYARSS-FSIDNIFPEQGGGRRLFQVARGISPNVGYYL 305
             L+      D VFLSPPWGGP Y R + + ++    +  G  +L + +  IS N+  +L
Sbjct: 63  AKLKFGKIPYDCVFLSPPWGGPSYKRQNVYDLEKKL-KPYGLYQLLKESTEISKNIILFL 121

Query: 306 PRTSDVFEI 314
           PR SD+ ++
Sbjct: 122 PRNSDLNQL 130


RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe Tgs1 and Giardia lamblia Tgs2 catalyze methylation of the exocyclic N2 amine of 7-methylguanosine. Length = 165

>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|216342 pfam01170, UPF0020, Putative RNA methylase family UPF0020 Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225174 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224017 COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223194 COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129627 TIGR00536, hemK_fam, HemK family putative methylases Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225318 COG2520, COG2520, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|129571 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>gnl|CDD|202251 pfam02475, Met_10, Met-10+ like-protein Back     alignment and domain information
>gnl|CDD|129628 TIGR00537, hemK_rel_arch, HemK-related putative methylase Back     alignment and domain information
>gnl|CDD|240367 PTZ00338, PTZ00338, dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236981 PRK11783, rlmL, 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233687 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234247 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>gnl|CDD|233303 TIGR01177, TIGR01177, TIGR01177 family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 342
KOG2730|consensus263 99.93
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.89
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.89
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.88
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 99.88
COG2265432 TrmA SAM-dependent methyltransferases related to t 99.87
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 99.87
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 99.87
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 99.86
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.83
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.76
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.66
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.65
KOG2187|consensus534 99.65
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 99.63
COG4123248 Predicted O-methyltransferase [General function pr 99.61
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.61
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.61
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 99.59
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.58
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.58
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.58
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.58
PHA03412241 putative methyltransferase; Provisional 99.57
COG2890280 HemK Methylase of polypeptide chain release factor 99.57
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.56
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.55
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.54
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.53
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.53
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.53
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.51
COG1041347 Predicted DNA modification methylase [DNA replicat 99.5
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.48
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.48
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.48
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.48
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.47
PRK14967223 putative methyltransferase; Provisional 99.46
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.44
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.44
PHA03411279 putative methyltransferase; Provisional 99.44
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.43
KOG2904|consensus328 99.43
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.42
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.41
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.4
KOG3420|consensus185 99.4
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.39
PRK14968188 putative methyltransferase; Provisional 99.39
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.39
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 99.38
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.38
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.37
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.36
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 99.36
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.35
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.35
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.35
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.35
PRK11207197 tellurite resistance protein TehB; Provisional 99.35
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.35
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.35
PRK14904445 16S rRNA methyltransferase B; Provisional 99.32
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 99.31
PLN02672 1082 methionine S-methyltransferase 99.31
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.3
KOG3926|consensus332 99.3
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.3
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.29
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.29
PRK14903431 16S rRNA methyltransferase B; Provisional 99.28
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.27
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.27
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.27
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.26
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.25
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.25
PLN02244340 tocopherol O-methyltransferase 99.25
KOG1271|consensus227 99.24
PRK14901434 16S rRNA methyltransferase B; Provisional 99.22
PRK10901427 16S rRNA methyltransferase B; Provisional 99.22
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.22
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.22
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.21
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.2
PRK12335287 tellurite resistance protein TehB; Provisional 99.2
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.18
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.18
PRK14902444 16S rRNA methyltransferase B; Provisional 99.17
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.16
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.14
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.14
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.12
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.12
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 99.12
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.11
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.11
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.11
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.11
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.11
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 99.1
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 99.09
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.09
PLN02233261 ubiquinone biosynthesis methyltransferase 99.09
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.09
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.08
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.08
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.07
COG2520341 Predicted methyltransferase [General function pred 99.07
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.07
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.07
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.07
PLN02476278 O-methyltransferase 99.05
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.04
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.04
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.03
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.02
KOG1270|consensus282 99.0
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.0
PLN02336475 phosphoethanolamine N-methyltransferase 99.0
KOG3191|consensus209 98.99
PRK05785226 hypothetical protein; Provisional 98.99
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.99
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.98
PRK07402196 precorrin-6B methylase; Provisional 98.96
PRK10742250 putative methyltransferase; Provisional 98.96
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.96
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.95
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.95
PRK04457262 spermidine synthase; Provisional 98.95
PRK00811283 spermidine synthase; Provisional 98.92
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.92
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.91
PRK04266226 fibrillarin; Provisional 98.9
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.9
PRK06922 677 hypothetical protein; Provisional 98.89
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.89
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.89
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.88
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.87
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.86
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 98.85
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.85
KOG2671|consensus421 98.85
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.84
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.84
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.83
PLN03075296 nicotianamine synthase; Provisional 98.83
TIGR00452314 methyltransferase, putative. Known examples to dat 98.82
PRK01581374 speE spermidine synthase; Validated 98.8
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.79
COG4122219 Predicted O-methyltransferase [General function pr 98.79
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.79
PRK06202232 hypothetical protein; Provisional 98.79
PLN02490340 MPBQ/MSBQ methyltransferase 98.78
TIGR03438301 probable methyltransferase. This model represents 98.78
KOG1540|consensus296 98.78
PRK04148134 hypothetical protein; Provisional 98.77
PLN02589247 caffeoyl-CoA O-methyltransferase 98.77
PRK03612521 spermidine synthase; Provisional 98.76
KOG0820|consensus 315 98.76
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.76
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.75
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.75
COG2521287 Predicted archaeal methyltransferase [General func 98.73
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.73
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 98.72
PRK08317241 hypothetical protein; Provisional 98.72
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 98.71
TIGR00438188 rrmJ cell division protein FtsJ. 98.69
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.68
PLN02336 475 phosphoethanolamine N-methyltransferase 98.68
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.67
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.64
PLN02366308 spermidine synthase 98.63
KOG1499|consensus 346 98.63
COG0286 489 HsdM Type I restriction-modification system methyl 98.62
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.57
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.57
KOG1500|consensus 517 98.55
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.55
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.54
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.53
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.51
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.5
PLN02823336 spermine synthase 98.48
PTZ00146293 fibrillarin; Provisional 98.47
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.45
COG4076252 Predicted RNA methylase [General function predicti 98.45
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.43
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 98.42
KOG1541|consensus270 98.42
KOG1663|consensus237 98.33
KOG4300|consensus252 98.29
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.21
COG3897218 Predicted methyltransferase [General function pred 98.19
KOG3010|consensus261 98.17
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 98.13
KOG2915|consensus314 98.13
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.13
COG2384226 Predicted SAM-dependent methyltransferase [General 98.1
KOG1661|consensus237 98.09
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 98.08
PF13679141 Methyltransf_32: Methyltransferase domain 98.06
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.04
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 98.03
KOG2899|consensus288 98.01
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.0
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.97
COG3129292 Predicted SAM-dependent methyltransferase [General 97.97
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.94
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.92
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.92
PRK11524284 putative methyltransferase; Provisional 97.92
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.92
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.91
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 97.86
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 97.85
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 97.83
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 97.8
PRK13699227 putative methylase; Provisional 97.77
PRK00536262 speE spermidine synthase; Provisional 97.69
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.68
COG4262508 Predicted spermidine synthase with an N-terminal m 97.65
KOG2078|consensus495 97.62
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.62
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.61
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.6
KOG1975|consensus 389 97.59
TIGR00497 501 hsdM type I restriction system adenine methylase ( 97.58
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.49
KOG1122|consensus460 97.49
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 97.48
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 97.42
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 97.31
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.23
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.22
KOG1227|consensus351 97.2
KOG4058|consensus199 97.19
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 97.16
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.14
PHA01634156 hypothetical protein 97.12
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.11
KOG2361|consensus264 97.1
KOG2912|consensus 419 97.08
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 96.99
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 96.92
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 96.91
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 96.86
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 96.85
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.83
PLN02232160 ubiquinone biosynthesis methyltransferase 96.66
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 96.63
KOG1501|consensus 636 96.62
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.56
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 96.53
KOG3045|consensus325 96.48
COG1568354 Predicted methyltransferases [General function pre 96.42
KOG2940|consensus 325 96.36
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 96.32
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.29
PRK10458 467 DNA cytosine methylase; Provisional 96.2
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.19
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 96.15
KOG1253|consensus 525 96.14
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 96.07
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.01
COG0863302 DNA modification methylase [DNA replication, recom 95.84
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 95.82
KOG2198|consensus375 95.7
KOG1269|consensus364 95.06
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 95.0
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 94.81
KOG4589|consensus232 94.76
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 94.72
KOG3115|consensus249 94.71
PF02086260 MethyltransfD12: D12 class N6 adenine-specific DNA 94.67
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 94.38
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 94.24
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 93.44
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 93.3
KOG1709|consensus271 92.9
COG2961279 ComJ Protein involved in catabolism of external DN 92.77
KOG3178|consensus342 92.71
KOG2360|consensus413 92.69
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 92.62
PF04378245 RsmJ: Ribosomal RNA small subunit methyltransferas 91.71
KOG2651|consensus 476 91.52
PRK11524 284 putative methyltransferase; Provisional 91.41
COG2933358 Predicted SAM-dependent methyltransferase [General 91.34
KOG3987|consensus288 91.17
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 91.13
PRK13699 227 putative methylase; Provisional 90.44
KOG2352|consensus 482 90.26
KOG3924|consensus419 89.99
KOG2793|consensus248 89.65
COG0338274 Dam Site-specific DNA methylase [DNA replication, 88.85
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 88.4
KOG2920|consensus282 88.21
KOG0919|consensus 338 87.59
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 87.58
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 87.52
KOG0822|consensus 649 87.48
PF02636252 Methyltransf_28: Putative S-adenosyl-L-methionine- 86.97
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 86.42
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 86.35
KOG2798|consensus369 85.89
KOG1201|consensus300 84.26
KOG3350|consensus217 84.06
KOG3201|consensus201 83.87
PRK06194 287 hypothetical protein; Provisional 83.74
PTZ00357 1072 methyltransferase; Provisional 83.6
COG3392 330 Adenine-specific DNA methylase [DNA replication, r 83.53
KOG0024|consensus354 83.42
PF07669106 Eco57I: Eco57I restriction-modification methylase; 83.41
PRK07523255 gluconate 5-dehydrogenase; Provisional 82.8
PRK08213259 gluconate 5-dehydrogenase; Provisional 82.72
KOG1596|consensus317 82.23
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 82.09
PRK05854 313 short chain dehydrogenase; Provisional 81.99
TIGR00571266 dam DNA adenine methylase (dam). All proteins in t 81.69
PRK05867253 short chain dehydrogenase; Provisional 81.56
COG1565 370 Uncharacterized conserved protein [Function unknow 81.46
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 81.07
KOG1331|consensus 293 80.56
COG1743 875 Adenine-specific DNA methylase containing a Zn-rib 80.38
>KOG2730|consensus Back     alignment and domain information
Probab=99.93  E-value=1.2e-26  Score=196.94  Aligned_cols=189  Identities=49%  Similarity=0.859  Sum_probs=167.5

Q ss_pred             CCChhhhcCcchhHHhhccchhhhccCcccccCCccccccCHHHHHHHHHHHhhcccccccCCCCCCHHHHHHHHHHhcC
Q psy15742        109 NVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCK  188 (342)
Q Consensus       109 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~e~~~~~i~~~~~  188 (342)
                      ..+.....+|.+.+||.+|+.+|+++|+++.++.++|+++||+.++..++.++...+                       
T Consensus        37 ~~~~~~~~~p~l~kywk~ryrlfsrfd~gi~md~e~wfsvTpe~ia~~iA~~v~~~~-----------------------   93 (263)
T KOG2730|consen   37 IESSKPAKNPELFKYWKNRYRLFSRFDSGIYMDREGWFSVTPEKIAEHIANRVVACM-----------------------   93 (263)
T ss_pred             ccccccCCChHHHHHHHHHHHHHHhhccceeecccceEEeccHHHHHHHHHHHHHhc-----------------------
Confidence            334556677899999999999999999999999999999999999999988875332                       


Q ss_pred             CCCeEEeccCCCcHHHHHHHHhCCEEEEEeCCHHHHHHHHHHHHHcCCCCcEEEEEccccccCCC-----CCccEEEEcC
Q psy15742        189 ASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPS-----LQGDVVFLSP  263 (342)
Q Consensus       189 ~~~~vLDlgcGtG~~~~~~a~~~~~v~gvD~s~~~l~~a~~n~~~~gl~~~i~~~~~D~~~~~~~-----~~~D~Ii~nP  263 (342)
                      ....|+|.+||.|+.++.+|..+..|++||+||.-+.+|++|++.+|++++++|++||+++....     ..+|.|+..|
T Consensus        94 ~~~~iidaf~g~gGntiqfa~~~~~VisIdiDPikIa~AkhNaeiYGI~~rItFI~GD~ld~~~~lq~~K~~~~~vf~sp  173 (263)
T KOG2730|consen   94 NAEVIVDAFCGVGGNTIQFALQGPYVIAIDIDPVKIACARHNAEVYGVPDRITFICGDFLDLASKLKADKIKYDCVFLSP  173 (263)
T ss_pred             CcchhhhhhhcCCchHHHHHHhCCeEEEEeccHHHHHHHhccceeecCCceeEEEechHHHHHHHHhhhhheeeeeecCC
Confidence            24589999999999999999999999999999999999999999999999999999999987532     2467999999


Q ss_pred             CCCCCcccc-ccccccccCcCCCCchhhhHhhhccCCCceeecCCCCCHHHHHHhhCCCc
Q psy15742        264 PWGGPEYAR-SSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKG  322 (342)
Q Consensus       264 P~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~l~~~~~~~~  322 (342)
                      ||++++|.. ..+|+..+.++  .+..++....+++++..+++|+|....+++.+..+..
T Consensus       174 pwggp~y~~~~~~DL~~~~~p--~~~~~fk~s~kispnv~~flprntdv~qls~~~~~~~  231 (263)
T KOG2730|consen  174 PWGGPSYLRADVYDLETHLKP--MGTKIFKSSLKISPNVAYFLPRNTDVNQLARLARKVL  231 (263)
T ss_pred             CCCCcchhhhhhhhhhhhcch--hHHHHHHhhhhcCcchhhhCCcchhHHHHHHhcCccc
Confidence            999999887 78899888877  5778999999999999999999999999998865543



>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>KOG3926|consensus Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG2078|consensus Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1227|consensus Back     alignment and domain information
>KOG4058|consensus Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>KOG2912|consensus Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG1501|consensus Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>KOG1253|consensus Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>KOG2360|consensus Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted Back     alignment and domain information
>KOG2651|consensus Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>KOG3924|consensus Back     alignment and domain information
>KOG2793|consensus Back     alignment and domain information
>COG0338 Dam Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>KOG2920|consensus Back     alignment and domain information
>KOG0919|consensus Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>KOG0822|consensus Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>KOG2798|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>KOG3350|consensus Back     alignment and domain information
>KOG3201|consensus Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>COG3392 Adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PF07669 Eco57I: Eco57I restriction-modification methylase; InterPro: IPR011639 This entry contains restriction modification methylases, which in the case of endonuclease Eco57I is found adjacent to the DNA cleavage domain, which recognises asymmetric DNA sequence 5'-CTGAAG [, ] Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00571 dam DNA adenine methylase (dam) Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
3gdh_A241 Methyltransferase Domain Of Human Trimethylguanosin 2e-48
3egi_A206 Methyltransferase Domain Of Human Trimethylguanosin 8e-42
2zzn_A336 The Complex Structure Of Atrm5 And Trnacys Length = 4e-04
2zzm_A336 The Complex Structure Of Atrm5 And Trnaleu Length = 8e-04
>pdb|3GDH|A Chain A, Methyltransferase Domain Of Human Trimethylguanosine Synthase 1 (Tgs1) Bound To M7gtp And Adenosyl-Homocysteine (Active Form) Length = 241 Back     alignment and structure

Iteration: 1

Score = 189 bits (480), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 99/217 (45%), Positives = 135/217 (62%), Gaps = 32/217 (14%) Query: 110 VPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVID 169 +P EI A P L KY+ QRY +SR+D+GI +D E Sbjct: 22 LPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDRE-------------------------- 55 Query: 170 GWYSVTPEKVAQHIASRCKAS---DVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRL 226 GW+SVTPEK+A+HIA R S DVV+D FCG GGNTIQFA +VI+IDIDP K+ L Sbjct: 56 GWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIAL 115 Query: 227 AQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARS-SFSIDNIFPEQG 285 A++NA VYG++ KI+FI GDF LA L+ DVVFLSPPWGGP+YA + +F I + Sbjct: 116 ARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPD- 174 Query: 286 GGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKG 322 G +F++++ I+ N+ Y+LPR +D+ ++ +G G Sbjct: 175 -GFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGG 210
>pdb|3EGI|A Chain A, Methyltransferase Domain Of Human Trimethylguanosine Synthase Tgs1 Bound To M7gpppa (Inactive Form) Length = 206 Back     alignment and structure
>pdb|2ZZN|A Chain A, The Complex Structure Of Atrm5 And Trnacys Length = 336 Back     alignment and structure
>pdb|2ZZM|A Chain A, The Complex Structure Of Atrm5 And Trnaleu Length = 336 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 4e-62
3ll7_A 410 Putative methyltransferase; methytransferase, stru 1e-24
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 8e-11
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 6e-10
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 2e-09
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 2e-09
2frn_A278 Hypothetical protein PH0793; structural genomics, 2e-09
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 6e-09
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 1e-08
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 1e-08
3ocj_A305 Putative exported protein; structural genomics, PS 1e-08
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 2e-08
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 3e-08
3lcc_A235 Putative methyl chloride transferase; halide methy 4e-08
3m70_A286 Tellurite resistance protein TEHB homolog; structu 5e-08
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 6e-08
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 1e-07
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 1e-07
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 2e-07
3lpm_A259 Putative methyltransferase; structural genomics, p 2e-07
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 3e-07
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 3e-07
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 5e-07
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 5e-07
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 6e-07
3f4k_A257 Putative methyltransferase; structural genomics, P 6e-07
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 1e-06
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 1e-06
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 1e-06
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 2e-06
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 2e-06
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 2e-06
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 3e-06
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 3e-06
1xxl_A239 YCGJ protein; structural genomics, protein structu 3e-06
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 4e-06
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 4e-06
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 1e-05
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 1e-05
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 1e-05
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 1e-05
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 2e-05
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 2e-05
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 2e-05
1ne2_A200 Hypothetical protein TA1320; structural genomics, 2e-05
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 2e-05
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 2e-05
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 2e-05
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 3e-05
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 3e-05
2b78_A385 Hypothetical protein SMU.776; structure genomics, 5e-05
1yb2_A275 Hypothetical protein TA0852; structural genomics, 6e-05
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 8e-05
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 9e-05
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 9e-05
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 9e-05
2qm3_A373 Predicted methyltransferase; putative methyltransf 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vl5_A260 Unknown conserved protein BH2331; putative methylt 1e-04
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 2e-04
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 2e-04
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 2e-04
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 2e-04
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 3e-04
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 3e-04
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 3e-04
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 3e-04
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 3e-04
3hnr_A220 Probable methyltransferase BT9727_4108; structural 3e-04
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 4e-04
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 4e-04
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 4e-04
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 4e-04
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 5e-04
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 5e-04
3m33_A226 Uncharacterized protein; structural genomics, PSI- 5e-04
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 6e-04
1wzn_A252 SAM-dependent methyltransferase; structural genomi 6e-04
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 6e-04
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 7e-04
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 7e-04
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
 Score =  197 bits (502), Expect = 4e-62
 Identities = 105/259 (40%), Positives = 148/259 (57%), Gaps = 44/259 (16%)

Query: 77  LPSEFGSQRKKKRRRKKRSFELNYQEDLGDLENVPEEIWANPYLNKYYQQRYLYWSRYDE 136
           L SE    +KKK ++K +            +  +P EI A P L KY+ QRY  +SR+D+
Sbjct: 3   LGSEV---KKKKNKKKNKK-----------VNGLPPEIAAVPELAKYWAQRYRLFSRFDD 48

Query: 137 GILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRCKASDVVIDG 196
           GI +D E W+SVTPEK+A+HIA R                         +    DVV+D 
Sbjct: 49  GIKLDREGWFSVTPEKIAEHIAGRVS-----------------------QSFKCDVVVDA 85

Query: 197 FCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQG 256
           FCG GGNTIQFA    +VI+IDIDP K+ LA++NA VYG++ KI+FI GDF  LA  L+ 
Sbjct: 86  FCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKA 145

Query: 257 DVVFLSPPWGGPEYARS-SFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIF 315
           DVVFLSPPWGGP+YA + +F I  +      G  +F++++ I+ N+ Y+LPR +D+ ++ 
Sbjct: 146 DVVFLSPPWGGPDYATAETFDIRTMMSP--DGFEIFRLSKKITNNIVYFLPRNADIDQVA 203

Query: 316 HDSGKKGSF----ISLTGR 330
             +G  G        L  +
Sbjct: 204 SLAGPGGQVEIEQNFLNNK 222


>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Length = 410 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Length = 336 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Length = 354 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Length = 373 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} SCOP: c.66.1.47 PDB: 3k6r_A 3a25_A* 3a26_A* Length = 278 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Length = 396 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Length = 393 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Length = 235 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Length = 286 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Length = 385 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Length = 393 Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Length = 384 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Length = 433 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Length = 425 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Length = 382 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Length = 207 Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Length = 258 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4er3_A* 3sr4_A* Length = 438 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Length = 396 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Length = 230 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Length = 703 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Length = 369 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Length = 284 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Length = 385 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Length = 258 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Length = 232 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Length = 373 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Length = 221 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Length = 381 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Length = 272 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Length = 332 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Length = 233 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Length = 170 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Length = 392 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.91
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.85
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.85
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.84
3ll7_A 410 Putative methyltransferase; methytransferase, stru 99.69
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.64
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.63
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.62
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.62
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.61
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.61
3lpm_A259 Putative methyltransferase; structural genomics, p 99.6
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.59
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.58
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.58
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.57
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.57
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.57
3k6r_A278 Putative transferase PH0793; structural genomics, 99.57
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.56
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.54
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.54
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.54
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.53
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.53
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.52
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.51
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.51
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.5
2h00_A254 Methyltransferase 10 domain containing protein; st 99.5
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.5
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.49
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.49
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.48
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.48
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.48
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.48
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.48
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.48
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.48
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.46
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 99.45
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.45
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.44
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.43
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.43
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.42
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 99.42
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.42
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.42
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.41
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.4
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.4
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.4
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.4
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.39
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.38
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.38
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.37
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.37
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.37
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 99.37
3f4k_A257 Putative methyltransferase; structural genomics, P 99.37
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.37
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.36
3lcc_A235 Putative methyl chloride transferase; halide methy 99.36
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.35
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.35
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.35
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.34
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.34
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.34
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 99.34
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 99.34
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.33
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.33
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.33
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.32
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.32
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.32
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.32
3lkd_A 542 Type I restriction-modification system methyltrans 99.32
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.31
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.31
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.31
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.3
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.3
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.3
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.3
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.3
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.3
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.29
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.29
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.29
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.29
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.29
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.29
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 99.29
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.29
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.29
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.29
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.28
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.28
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 99.28
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.27
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.26
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.26
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.26
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.26
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.25
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.25
3ocj_A305 Putative exported protein; structural genomics, PS 99.25
3fut_A271 Dimethyladenosine transferase; methyltransferase, 99.25
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.25
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.25
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.25
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 99.25
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.24
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.24
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.24
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.24
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.24
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.24
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.24
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.24
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.23
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.23
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 99.23
3khk_A 544 Type I restriction-modification system methylation 99.23
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.22
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.22
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.22
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.22
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.22
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.22
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.21
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.21
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.21
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 99.21
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.2
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.2
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 99.2
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.2
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.19
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.19
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.19
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.19
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 99.19
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.19
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.18
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.18
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.18
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.18
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.18
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.17
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.17
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.17
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.17
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.17
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.17
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.17
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.17
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.16
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.16
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.16
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.16
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.16
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.15
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.15
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.14
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.14
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.14
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.14
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.14
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.13
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 99.13
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.13
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.12
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.12
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.11
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.11
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.11
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.11
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.1
2b25_A336 Hypothetical protein; structural genomics, methyl 99.1
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.09
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.09
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.09
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 99.09
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.09
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.09
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.09
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 99.08
3ufb_A 530 Type I restriction-modification system methyltran 99.08
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.08
2pt6_A321 Spermidine synthase; transferase, structural genom 99.08
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.08
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.08
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.07
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.07
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.07
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.07
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.05
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.05
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.05
2o07_A304 Spermidine synthase; structural genomics, structur 99.05
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.05
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.04
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.04
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.04
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 99.03
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.03
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.03
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 99.02
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.02
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.02
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.02
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.02
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.02
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.01
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.01
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.01
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.01
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.01
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.0
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.98
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.97
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.95
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.95
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.93
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.92
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.92
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.91
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.91
2i7c_A283 Spermidine synthase; transferase, structural genom 98.9
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.89
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.85
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.85
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.83
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.82
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.82
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.81
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.81
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.8
3cc8_A230 Putative methyltransferase; structural genomics, j 98.78
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.78
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.77
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.77
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.75
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.75
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.73
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.71
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.7
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.69
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.68
2oo3_A283 Protein involved in catabolism of external DNA; st 98.68
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.68
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.67
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.65
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.63
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.63
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.63
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.62
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.62
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.58
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.58
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.58
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.5
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.49
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 98.45
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.4
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.4
2zig_A297 TTHA0409, putative modification methylase; methylt 98.4
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.36
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.35
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 98.32
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.32
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.28
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 98.21
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.2
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.17
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.17
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.13
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 98.08
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.08
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 98.07
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.04
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.02
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 98.0
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.94
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.86
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 97.86
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 97.79
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 97.77
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 97.76
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 97.74
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 97.72
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.69
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 97.69
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.68
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 97.67
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 97.54
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 97.52
3me5_A 482 Cytosine-specific methyltransferase; structural ge 97.21
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.03
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.02
2px2_A269 Genome polyprotein [contains: capsid protein C (co 96.75
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 96.64
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 96.58
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 96.47
4dkj_A 403 Cytosine-specific methyltransferase; CG-specificit 96.24
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 95.95
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 95.48
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 93.73
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 92.93
2zig_A 297 TTHA0409, putative modification methylase; methylt 92.84
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 92.6
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 91.48
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 90.94
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 90.63
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.62
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 89.99
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 89.17
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 88.77
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 88.41
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 88.13
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 87.81
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 87.76
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 87.29
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 87.24
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 86.91
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 86.76
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 86.7
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 86.64
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 86.55
2dpm_A284 M.dpnii 1, protein (adenine-specific methyltransfe 86.19
1lss_A140 TRK system potassium uptake protein TRKA homolog; 85.85
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 85.83
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 85.53
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 85.52
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 85.24
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 85.05
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 84.82
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 84.37
1yf3_A259 DNA adenine methylase; T4DAM, methyltransferase, t 84.21
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 84.06
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 83.82
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 83.8
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 83.78
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 83.71
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 83.44
4g65_A 461 TRK system potassium uptake protein TRKA; structur 83.43
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 83.3
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 83.15
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 83.04
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 82.68
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 82.61
2g1p_A278 DNA adenine methylase; DAM methylation, GATC recog 82.57
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 82.55
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 82.49
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 82.46
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 82.37
2dpm_A284 M.dpnii 1, protein (adenine-specific methyltransfe 82.23
2g1p_A278 DNA adenine methylase; DAM methylation, GATC recog 81.83
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 81.71
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 81.43
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 81.35
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 81.26
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 81.24
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 81.2
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 81.04
3cxt_A291 Dehydrogenase with different specificities; rossma 80.85
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 80.72
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 80.7
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 80.59
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 80.48
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 80.44
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 80.4
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 80.37
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 80.34
1id1_A153 Putative potassium channel protein; RCK domain, E. 80.33
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 80.19
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 80.08
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
Probab=99.91  E-value=2.1e-23  Score=186.03  Aligned_cols=192  Identities=51%  Similarity=0.933  Sum_probs=161.5

Q ss_pred             CCCChhhhcCcchhHHhhccchhhhccCcccccCCccccccCHHHHHHHHHHHhhcccccccCCCCCCHHHHHHHHHHhc
Q psy15742        108 ENVPEEIWANPYLNKYYQQRYLYWSRYDEGILMDEESWYSVTPEKVAQHIASRCKASDVVIDGWYSVTPEKVAQHIASRC  187 (342)
Q Consensus       108 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~e~~~~~i~~~~  187 (342)
                      ..+|.....++.+.++|.++...+..++.++..+..+|++.+++.++..+...+..                       .
T Consensus        20 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~-----------------------~   76 (241)
T 3gdh_A           20 NGLPPEIAAVPELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQ-----------------------S   76 (241)
T ss_dssp             --CCHHHHHCGGGHHHHHTHHHHCTTGGGTCCCCHHHHHHCCCHHHHHHHHHHHHH-----------------------H
T ss_pred             CCCChhhhccHHHHHHHHhhhhhHhhccCCceecccceeecCHHHHHHHHHHHhhh-----------------------c
Confidence            35666677778899999999999999888888888889988888776666554421                       1


Q ss_pred             CCCCeEEeccCCCcHHHHHHHHhCCEEEEEeCCHHHHHHHHHHHHHcCCCCcEEEEEccccccCCCCCccEEEEcCCCCC
Q psy15742        188 KASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGG  267 (342)
Q Consensus       188 ~~~~~vLDlgcGtG~~~~~~a~~~~~v~gvD~s~~~l~~a~~n~~~~gl~~~i~~~~~D~~~~~~~~~~D~Ii~nPP~~~  267 (342)
                      .++.+|||+|||+|.+++.+++.+.+|+|+|+|+.+++.|++|++.+++.++++++++|+.++++..+||+|++||||++
T Consensus        77 ~~~~~vLD~gcG~G~~~~~la~~~~~v~~vD~s~~~~~~a~~~~~~~~~~~~~~~~~~d~~~~~~~~~~D~v~~~~~~~~  156 (241)
T 3gdh_A           77 FKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGG  156 (241)
T ss_dssp             SCCSEEEETTCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTTCGGGEEEEESCHHHHGGGCCCSEEEECCCCSS
T ss_pred             cCCCEEEECccccCHHHHHHHHcCCEEEEEECCHHHHHHHHHHHHHcCCCcCeEEEECChHHhcccCCCCEEEECCCcCC
Confidence            24789999999999999999999999999999999999999999999986689999999999877779999999999998


Q ss_pred             Ccccc-ccccccccCcCCCCchhhhHhhhccCCCceeecCCCCCHHHHHHhhCCCcEE
Q psy15742        268 PEYAR-SSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSDVFEIFHDSGKKGSF  324 (342)
Q Consensus       268 ~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~l~~~~~~~~~i  324 (342)
                      ..... ...++.+++.+  ||..+++......++..+++|++....++..++.+++.+
T Consensus       157 ~~~~~~~~~~~~~~L~p--gG~~i~~~~~~~~~~~~~~lp~~~~~~~~~~~l~~~g~~  212 (241)
T 3gdh_A          157 PDYATAETFDIRTMMSP--DGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQV  212 (241)
T ss_dssp             GGGGGSSSBCTTTSCSS--CHHHHHHHHHHHCSCEEEEEETTBCHHHHHHTTCTTCCE
T ss_pred             cchhhhHHHHHHhhcCC--cceeHHHHHHhhCCceEEECCCCCCHHHHHHHhccCCCE
Confidence            76544 44556667766  788889988999999999999999999999988776543



>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2dpm_A M.dpnii 1, protein (adenine-specific methyltransferase dpnii 1); DNA adenine methyltransferase, methylase; HET: SAM; 1.80A {Streptococcus pneumoniae} SCOP: c.66.1.28 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1yf3_A DNA adenine methylase; T4DAM, methyltransferase, transferase-DNA complex; HET: DNA SAH; 2.29A {Enterobacteria phage T4} SCOP: c.66.1.28 PDB: 1yfj_A* 1yfl_A* 1q0s_A* 1q0t_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2g1p_A DNA adenine methylase; DAM methylation, GATC recognition, base flipping, bacterial factor, transferase-DNA complex; HET: DNA SAH; 1.89A {Escherichia coli} PDB: 2ore_D* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2dpm_A M.dpnii 1, protein (adenine-specific methyltransferase dpnii 1); DNA adenine methyltransferase, methylase; HET: SAM; 1.80A {Streptococcus pneumoniae} SCOP: c.66.1.28 Back     alignment and structure
>2g1p_A DNA adenine methylase; DAM methylation, GATC recognition, base flipping, bacterial factor, transferase-DNA complex; HET: DNA SAH; 1.89A {Escherichia coli} PDB: 2ore_D* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 342
d2frna1260 c.66.1.47 (A:19-278) Hypothetical protein PH0793 { 1e-11
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 3e-10
d2oyra1250 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shi 3e-06
d2igta1309 c.66.1.51 (A:1-309) Putative methyltransferase Atu 3e-06
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 1e-05
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 4e-05
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 4e-05
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 2e-04
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 2e-04
d2dula1 375 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tR 3e-04
d1o9ga_249 c.66.1.29 (A:) rRNA methyltransferase AviRa {Strep 4e-04
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 9e-04
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Met-10+ protein-like
domain: Hypothetical protein PH0793
species: Pyrococcus horikoshii [TaxId: 53953]
 Score = 61.7 bits (149), Expect = 1e-11
 Identities = 23/114 (20%), Positives = 41/114 (35%), Gaps = 2/114 (1%)

Query: 165 DVVIDGWYSVTPEKVAQHIASRCKASDVVIDGFCGCGGNTIQFA-AVCQKVISIDIDPAK 223
           DV    +     +     +A   K  ++V+D F G G  ++  A     KVI+I+ DP  
Sbjct: 84  DVAKIMFSPANVK-ERVRMAKVAKPDELVVDMFAGIGHLSLPIAVYGKAKVIAIEKDPYT 142

Query: 224 LRLAQHNASVYGVSHKIQFIQGDFFALAPSLQGDVVFLSPPWGGPEYARSSFSI 277
            +    N  +  V  ++     D          D + +       E+   + SI
Sbjct: 143 FKFLVENIHLNKVEDRMSAYNMDNRDFPGENIADRILMGYVVRTHEFIPKALSI 196


>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Length = 250 Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Length = 309 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Length = 375 Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Length = 249 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.89
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.68
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.68
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.67
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.66
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.66
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.63
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.62
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.61
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.61
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.61
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.6
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.58
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.58
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.57
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.57
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.55
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.53
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.5
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.5
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.5
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.49
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.48
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.48
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.46
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.45
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.44
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.44
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.43
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.41
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.39
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 99.39
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.38
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.37
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.37
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.33
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.3
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.29
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.25
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.25
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.25
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.24
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.24
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.2
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.19
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.18
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.16
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.15
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.14
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.13
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.13
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.13
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 99.12
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 99.11
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 99.09
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.08
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.08
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.08
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 99.07
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.06
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.03
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.01
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.98
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.97
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 98.97
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.94
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.91
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.9
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.89
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.89
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 98.88
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.88
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 98.86
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.83
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.83
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.81
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.74
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.68
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.68
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.68
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.67
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.63
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.59
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.58
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.52
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.48
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.42
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.36
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.26
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.21
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.18
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.16
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.1
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.08
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 98.0
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 97.87
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 97.87
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 97.86
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 97.71
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 97.4
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 97.39
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.35
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.27
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.25
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.25
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 96.84
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 96.81
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 96.51
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.18
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.62
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.99
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.98
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.67
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.22
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 92.83
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 92.65
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 92.62
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 92.22
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.13
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 91.92
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.74
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 91.5
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 91.32
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 91.15
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 91.03
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.62
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.54
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 90.42
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 90.37
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 90.29
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 90.21
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 90.16
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 89.9
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 89.35
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 89.33
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 89.0
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 88.94
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 88.59
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.56
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 88.34
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.13
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 87.85
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 87.58
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 87.36
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 87.17
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 86.9
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 86.85
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 86.73
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.65
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 86.6
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 86.41
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 86.39
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 86.18
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 86.06
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 85.6
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 85.3
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 85.18
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 85.13
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 84.47
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 84.18
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 83.86
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 83.84
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 83.67
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 83.44
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 83.26
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 83.2
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 82.08
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 81.9
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 81.88
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 81.41
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 81.09
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 80.56
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 80.29
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 80.06
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: (Uracil-5-)-methyltransferase
domain: rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain
species: Escherichia coli [TaxId: 562]
Probab=99.89  E-value=1.4e-23  Score=196.12  Aligned_cols=155  Identities=20%  Similarity=0.266  Sum_probs=122.3

Q ss_pred             cCCCCCCH---HHHHHHHHHhcC--CCCeEEeccCCCcHHHHHHHHhCCEEEEEeCCHHHHHHHHHHHHHcCCCCcEEEE
Q psy15742        169 DGWYSVTP---EKVAQHIASRCK--ASDVVIDGFCGCGGNTIQFAAVCQKVISIDIDPAKLRLAQHNASVYGVSHKIQFI  243 (342)
Q Consensus       169 ~~~~~~~~---e~~~~~i~~~~~--~~~~vLDlgcGtG~~~~~~a~~~~~v~gvD~s~~~l~~a~~n~~~~gl~~~i~~~  243 (342)
                      .+||+.++   +.+.+.+.+.++  ++.+|+|++||+|.+++.+|+.+.+|+|+|.++.+++.|++|++.||+. +++|+
T Consensus       187 ~sFfQ~N~~~~e~l~~~v~~~~~~~~~~~vlDLycG~G~fsl~La~~~~~V~gvE~~~~ai~~A~~na~~n~i~-n~~~~  265 (358)
T d1uwva2         187 RDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVVGVEGVPALVEKGQQNARLNGLQ-NVTFY  265 (358)
T ss_dssp             SSCCCSBHHHHHHHHHHHHHHHTCCTTCEEEEESCTTTTTHHHHHTTSSEEEEEESCHHHHHHHHHHHHHTTCC-SEEEE
T ss_pred             chhhccchhhhhHHHHHHHHhhccCCCceEEEecccccccchhccccccEEEeccCcHHHHHHHHHhHHhcccc-cceee
Confidence            46888887   566667776654  6789999999999999999999999999999999999999999999994 89999


Q ss_pred             EccccccCC-----CCCccEEEEcCCCCCCccccccccccccCcCCCCchhhhHhhhccCCCceeecCCCCC-HHHHHHh
Q psy15742        244 QGDFFALAP-----SLQGDVVFLSPPWGGPEYARSSFSIDNIFPEQGGGRRLFQVARGISPNVGYYLPRTSD-VFEIFHD  317 (342)
Q Consensus       244 ~~D~~~~~~-----~~~~D~Ii~nPP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~-~~~l~~~  317 (342)
                      .+|..+...     ...+|+|++|||+.|..                 . .+..+...-.+.++|+.+.-.+ .+++..+
T Consensus       266 ~~~~~~~~~~~~~~~~~~d~vilDPPR~G~~-----------------~-~~~~l~~~~~~~ivYVSCnp~TlaRDl~~l  327 (358)
T d1uwva2         266 HENLEEDVTKQPWAKNGFDKVLLDPARAGAA-----------------G-VMQQIIKLEPIRIVYVSCNPATLARDSEAL  327 (358)
T ss_dssp             ECCTTSCCSSSGGGTTCCSEEEECCCTTCCH-----------------H-HHHHHHHHCCSEEEEEESCHHHHHHHHHHH
T ss_pred             ecchhhhhhhhhhhhccCceEEeCCCCccHH-----------------H-HHHHHHHcCCCEEEEEeCCHHHHHHHHHHH
Confidence            999987652     24699999999999873                 1 2233333334455555422122 2346666


Q ss_pred             hCCCcEEEEecccCCCCCCCccccC
Q psy15742        318 SGKKGSFISLTGRQMFSPSQDMETV  342 (342)
Q Consensus       318 ~~~~~~i~~i~~~~~fp~t~h~e~~  342 (342)
                      ...||++..++++||||+|+|+|+|
T Consensus       328 ~~~gy~l~~i~~~D~FP~T~HvE~v  352 (358)
T d1uwva2         328 LKAGYTIARLAMLDMFPHTGHLESM  352 (358)
T ss_dssp             HHTTCEEEEEEEECCSTTSSCCEEE
T ss_pred             HHCCCeEeEEEEEecCCCCccEEEE
Confidence            6789999999999999999999986



>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure