Diaphorina citri psyllid: psy15749


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MFRIFKSMLVGIPISITFCDSIGYVARVDGTSMQPVFNPDRNHQDYVFLNRWIIKGDDIGLQRGDIVSLVSPKDPGQKIIKRIVGVEGDVVSTLDYKSNVVKVPQGHIWVEGDHVGHSMDSNMFGPVSMGLVTAKASSIIWPPSRWQYLKSEVPVHRLNAIITS
cHHHHHHHHHHHHHHHHEEcEEEEEEECcccccccccccccccccEEEEEccEEEccccccccccEEEEEccccccccEEEEEEEEcccEEEcccccccCEEcccccEEEEccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccc
MFRIFKSMLVGIPISITFCDSIGYVARVDGTSMQPVFNPDRNHQDYVFLNRWIIKGDDIGLQRGDIVSLVSPKDPGQKIIKRIVGVEGDVVSTLDYKSNVVKVPQGHIWVEGDHVGHSMDSNMFGPVSMGLVTAKASSIIWPPSRWQYLKSEVPV*********
xxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRIFKSMLVGIPISITFCDSIGYVARVDGTSMQPVFNPDRNHQDYVFLNRWIIKGDDIGLQRGDIVSLVSPKDPGQKIIKRIVGVEGDVVSTLDYKSNVVKVPQGHIWVEGDHVGHSMDSNMFGPVSMGLVTAKASSIIWPPSRWQYLKSEVPVHRLNAIITS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial inner membrane protease subunit 2 Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.very confidentQ96T52
Mitochondrial inner membrane protease subunit 2 Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.very confidentQ2KI92
Mitochondrial inner membrane protease subunit 2 Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.very confidentQ8BPT6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0007283 [BP]spermatogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0042720 [CC]mitochondrial inner membrane peptidase complexprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0006627 [BP]protein processing involved in protein targeting to mitochondrionprobableGO:0008104, GO:0051649, GO:0006839, GO:0034982, GO:0071840, GO:0044699, GO:0044267, GO:0044260, GO:0070727, GO:0006886, GO:0016043, GO:0071704, GO:0010467, GO:0007005, GO:0071702, GO:0051641, GO:0006810, GO:0044238, GO:0072594, GO:0006626, GO:0034613, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0044763, GO:0008152, GO:0072655, GO:0016485, GO:0051234, GO:0051179, GO:0016482, GO:0006996, GO:0070585, GO:0033036, GO:0046907, GO:0051604, GO:0019538, GO:0044237, GO:0043170, GO:0015031, GO:0008150, GO:0009987
GO:0008236 [MF]serine-type peptidase activityprobableGO:0016787, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233
GO:0001541 [BP]ovarian follicle developmentprobableGO:0022602, GO:0061458, GO:0008585, GO:0048608, GO:0007275, GO:0044699, GO:0000003, GO:0008406, GO:0045137, GO:0048511, GO:0048513, GO:0032502, GO:0032501, GO:0046545, GO:0048609, GO:0032504, GO:0044767, GO:0022414, GO:0008150, GO:0046660, GO:0007548, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0042698, GO:0048731
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0030728 [BP]ovulationprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0007276, GO:0044699, GO:0000003
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B12, chain A
Confidence level:very confident
Coverage over the Query: 19-144
View the alignment between query and template
View the model in PyMOL