Diaphorina citri psyllid: psy15750

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MLVGIPIGITFCDSIGYVARVDGTSMQPVCPSTYMDTLYCSIEESESGTKRPISVDTVLTLDKSTGLLIDAWGKNKFYMPHGCTVDNKGFIWLTDVALHQVFKTPYTYNFGDMTV
cCCccCEEEEEEccccEEEEECcCCcccccccccccccEEccccCEEcccccccccEEEEECcccccEEEHcccccEEccCEEEEcccccEEEEEccccEEEECccccccccccc
MLVGIPIGITFCDSIGYVARVDGTSMQPVCPSTYMDTLYCSIEESESGTKRPISVDTVLTLDKSTGLLIDAWGKNKFYMPHGCTVDNKGFIWLTDVALHQVFKTPYTYNFGDM**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVGIPIGITFCDSIGYVARVDGTSMQPVCPSTYMDTLYCSIEESESGTKRPISVDTVLTLDKSTGLLIDAWGKNKFYMPHGCTVDNKGFIWLTDVALHQVFKTPYTYNFGDMTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-glycine alpha-amidating monooxygenase Bifunctional enzyme that catalyzes 2 sequential steps in C-terminal alpha-amidation of peptides. The monooxygenase part produces an unstable peptidyl(2-hydroxyglycine) intermediate that is dismutated to glyoxylate and the corresponding desglycine peptide amide by the lyase part. C-terminal amidation of peptides such as neuropeptides is essential for full biological activity.confidentP14925
Peptidyl-glycine alpha-amidating monooxygenase Bifunctional enzyme that catalyzes 2 sequential steps in C-terminal alpha-amidation of peptides. The monooxygenase part produces an unstable peptidyl(2-hydroxyglycine) intermediate that is dismutated to glyoxylate and the corresponding desglycine peptide amide by the lyase part. C-terminal amidation of peptides such as neuropeptides is essential for full biological activity.confidentP97467
Peptidyl-glycine alpha-amidating monooxygenase Bifunctional enzyme that catalyzes 2 sequential steps in C-terminal alpha-amidation of peptides. The monooxygenase part produces an unstable peptidyl(2-hydroxyglycine) intermediate that is dismutated to glyoxylate and the corresponding desglycine peptide amide by the lyase part. C-terminal amidation of peptides such as neuropeptides is essential for full biological activity.confidentP10731

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0001519 [BP]peptide amidationprobableGO:1901564, GO:0043603, GO:0009987, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006518, GO:0031179
GO:0018032 [BP]protein amidationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001676 [BP]long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0009268 [BP]response to pHprobableGO:0009628, GO:0050896, GO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0030667 [CC]secretory granule membraneprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030141, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0009404 [BP]toxin metabolic processprobableGO:0044710, GO:0019748, GO:0009987, GO:0044237, GO:0008150, GO:0008152
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0004598 [MF]peptidylamidoglycolate lyase activityprobableGO:0003824, GO:0016829, GO:0003674, GO:0016840, GO:0016842
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FVZ, chain A
Confidence level:very confident
Coverage over the Query: 17-110
View the alignment between query and template
View the model in PyMOL