Psyllid ID: psy15750
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| 242011741 | 361 | peptidyl-glycine alpha-amidating monooxy | 0.686 | 0.218 | 0.481 | 1e-14 | |
| 321460202 | 378 | hypothetical protein DAPPUDRAFT_327379 [ | 0.469 | 0.142 | 0.648 | 4e-14 | |
| 401721259 | 699 | peptidylglycine alpha-amidating monooxyg | 0.539 | 0.088 | 0.580 | 5e-14 | |
| 307169779 | 369 | Peptidyl-alpha-hydroxyglycine alpha-amid | 0.521 | 0.162 | 0.6 | 2e-13 | |
| 427780697 | 764 | Putative peptidylglycine alpha-amidating | 0.556 | 0.083 | 0.514 | 3e-13 | |
| 291232539 | 589 | PREDICTED: peptidylglycine alpha-amidati | 0.521 | 0.101 | 0.55 | 4e-13 | |
| 12004982 | 984 | peptidylglycine alpha-amidating monooxyg | 0.547 | 0.064 | 0.571 | 3e-12 | |
| 390351805 | 694 | PREDICTED: uncharacterized protein LOC58 | 0.469 | 0.077 | 0.592 | 3e-12 | |
| 12004980 | 984 | peptidylglycine alpha-amidating monooxyg | 0.547 | 0.064 | 0.571 | 3e-12 | |
| 158285357 | 536 | AGAP007606-PA [Anopheles gambiae str. PE | 0.504 | 0.108 | 0.568 | 4e-12 |
| >gi|242011741|ref|XP_002426605.1| peptidyl-glycine alpha-amidating monooxygenase, putative [Pediculus humanus corporis] gi|212510754|gb|EEB13867.1| peptidyl-glycine alpha-amidating monooxygenase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 84.0 bits (206), Expect = 1e-14, Method: Compositional matrix adjust.
Identities = 40/83 (48%), Positives = 55/83 (66%), Gaps = 4/83 (4%)
Query: 25 SMQPVC----PSTYMDTLYCSIEESESGTKRPISVDTVLTLDKSTGLLIDAWGKNKFYMP 80
+ QPV P + +T + + + + PISVDT+LTLD TG +I++WG N FYMP
Sbjct: 75 NHQPVIFHRGPRVWDETSFNESHQFQYVNQGPISVDTILTLDSDTGEVINSWGSNFFYMP 134
Query: 81 HGCTVDNKGFIWLTDVALHQVFK 103
HG T+DN G+ ++TDVALHQ FK
Sbjct: 135 HGLTIDNYGYYYMTDVALHQAFK 157
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321460202|gb|EFX71247.1| hypothetical protein DAPPUDRAFT_327379 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|401721259|gb|AFP99910.1| peptidylglycine alpha-amidating monooxygenase 2 [Acropora millepora] | Back alignment and taxonomy information |
|---|
| >gi|307169779|gb|EFN62324.1| Peptidyl-alpha-hydroxyglycine alpha-amidating lyase 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|427780697|gb|JAA55800.1| Putative peptidylglycine alpha-amidating monooxygenase [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|291232539|ref|XP_002736199.1| PREDICTED: peptidylglycine alpha-amidating monooxygenase-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|12004982|gb|AAG44251.1| peptidylglycine alpha-amidating monooxygenase [Calliactis parasitica] | Back alignment and taxonomy information |
|---|
| >gi|390351805|ref|XP_792034.3| PREDICTED: uncharacterized protein LOC587198 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|12004980|gb|AAG44250.1| peptidylglycine alpha-amidating monooxygenase [Calliactis parasitica] | Back alignment and taxonomy information |
|---|
| >gi|158285357|ref|XP_308266.4| AGAP007606-PA [Anopheles gambiae str. PEST] gi|157019953|gb|EAA04373.4| AGAP007606-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| FB|FBgn0033466 | 541 | Pal1 "Peptidyl-alpha-hydroxygl | 0.469 | 0.099 | 0.592 | 3.1e-12 | |
| FB|FBgn0262728 | 406 | Pal2 "Peptidyl-alpha-hydroxygl | 0.486 | 0.137 | 0.508 | 1e-11 | |
| UNIPROTKB|E2R682 | 679 | PAM "Uncharacterized protein" | 0.452 | 0.076 | 0.538 | 1.1e-10 | |
| UNIPROTKB|F6X870 | 807 | PAM "Uncharacterized protein" | 0.452 | 0.064 | 0.538 | 1.4e-10 | |
| UNIPROTKB|H7BYD9 | 679 | PAM "Peptidyl-alpha-hydroxygly | 0.452 | 0.076 | 0.519 | 1.5e-10 | |
| UNIPROTKB|F1RN59 | 983 | PAM "Uncharacterized protein" | 0.452 | 0.052 | 0.519 | 1.9e-10 | |
| UNIPROTKB|F1Q4G4 | 1017 | PAM "Uncharacterized protein" | 0.452 | 0.051 | 0.538 | 2e-10 | |
| UNIPROTKB|F8WE90 | 875 | PAM "Peptidyl-alpha-hydroxygly | 0.452 | 0.059 | 0.519 | 2.1e-10 | |
| UNIPROTKB|F1MZN4 | 954 | PAM "Peptidylglycine alpha-hyd | 0.452 | 0.054 | 0.519 | 2.3e-10 | |
| UNIPROTKB|F1MZB4 | 972 | PAM "Peptidylglycine alpha-hyd | 0.452 | 0.053 | 0.519 | 2.4e-10 |
| FB|FBgn0033466 Pal1 "Peptidyl-alpha-hydroxyglycine-alpha-amidating lyase 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 173 (66.0 bits), Expect = 3.1e-12, P = 3.1e-12
Identities = 32/54 (59%), Positives = 39/54 (72%)
Query: 52 PISVDTVLTLDKSTGLLIDAWGKNKFYMPHGCTVDNKGFIWLTDVALHQVFKTP 105
PI T+L L+ +TG + WGKN FYMPHG TVD + +WLTDVA+HQVFK P
Sbjct: 150 PIRESTILALEPATGKVQYDWGKNFFYMPHGLTVDPEDNVWLTDVAMHQVFKFP 203
|
|
| FB|FBgn0262728 Pal2 "Peptidyl-alpha-hydroxyglycine-alpha-amidating lyase 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R682 PAM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6X870 PAM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7BYD9 PAM "Peptidyl-alpha-hydroxyglycine alpha-amidating lyase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RN59 PAM "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q4G4 PAM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8WE90 PAM "Peptidyl-alpha-hydroxyglycine alpha-amidating lyase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MZN4 PAM "Peptidylglycine alpha-hydroxylating monooxygenase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MZB4 PAM "Peptidylglycine alpha-hydroxylating monooxygenase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| pfam01436 | 28 | pfam01436, NHL, NHL repeat | 1e-04 |
| >gnl|CDD|110440 pfam01436, NHL, NHL repeat | Back alignment and domain information |
|---|
Score = 36.2 bits (85), Expect = 1e-04
Identities = 10/27 (37%), Positives = 15/27 (55%)
Query: 77 FYMPHGCTVDNKGFIWLTDVALHQVFK 103
F PHG VD+ G +++ D H+V
Sbjct: 1 FNRPHGVAVDSDGDVYVADSENHRVQV 27
|
The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies. It is about 40 residues long and resembles the WD repeat pfam00400. The repeats have a catalytic activity in bovine PAM (peptidyl-glycine alpha-amidating monooxygenase), proteolysis has shown that the Peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL) activity is localised to the repeats. Human E3 ubiquitin-protein ligase TRIM32 interacts with the activation domain of Tat. This interaction is me diated by the NHL repeats. Length = 28 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| KOG1568|consensus | 174 | 99.52 | ||
| KOG3567|consensus | 501 | 99.29 | ||
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 99.16 | |
| TIGR02227 | 163 | sigpep_I_bact signal peptidase I, bacterial type. | 99.06 | |
| PRK10861 | 324 | signal peptidase I; Provisional | 99.0 | |
| KOG0171|consensus | 176 | 98.9 | ||
| COG0681 | 166 | LepB Signal peptidase I [Intracellular trafficking | 98.19 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.18 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.04 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 97.93 | |
| TIGR02754 | 90 | sod_Ni_protease nickel-type superoxide dismutase m | 97.54 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 97.33 | |
| cd06530 | 85 | S26_SPase_I The S26 Type I signal peptidase (SPase | 97.09 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 96.82 | |
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 96.69 | |
| PF00717 | 70 | Peptidase_S24: Peptidase S24-like peptidase classi | 96.65 | |
| TIGR02228 | 158 | sigpep_I_arch signal peptidase I, archaeal type. T | 96.56 | |
| KOG3567|consensus | 501 | 96.44 | ||
| COG4257 | 353 | Vgb Streptogramin lyase [Defense mechanisms] | 96.28 | |
| PF06739 | 38 | SBBP: Beta-propeller repeat; InterPro: IPR010620 T | 96.17 | |
| PF01731 | 86 | Arylesterase: Arylesterase; InterPro: IPR002640 Th | 96.16 | |
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 96.04 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 95.8 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 95.48 | |
| KOG4499|consensus | 310 | 95.28 | ||
| TIGR03032 | 335 | conserved hypothetical protein TIGR03032. This pro | 95.16 | |
| COG3386 | 307 | Gluconolactonase [Carbohydrate transport and metab | 95.05 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 94.79 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 94.41 | |
| cd06462 | 84 | Peptidase_S24_S26 The S24, S26 LexA/signal peptida | 94.3 | |
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 94.26 | |
| COG3391 | 381 | Uncharacterized conserved protein [Function unknow | 94.16 | |
| TIGR03118 | 336 | PEPCTERM_chp_1 conserved hypothetical protein TIGR | 94.15 | |
| PF13449 | 326 | Phytase-like: Esterase-like activity of phytase | 92.92 | |
| COG2932 | 214 | Predicted transcriptional regulator [Transcription | 92.29 | |
| cd06529 | 81 | S24_LexA-like Peptidase S24 LexA-like proteins are | 92.28 | |
| TIGR02604 | 367 | Piru_Ver_Nterm putative membrane-bound dehydrogena | 92.19 | |
| PF06977 | 248 | SdiA-regulated: SdiA-regulated; InterPro: IPR00972 | 91.98 | |
| PF03022 | 287 | MRJP: Major royal jelly protein; InterPro: IPR0035 | 91.07 | |
| COG3204 | 316 | Uncharacterized protein conserved in bacteria [Fun | 90.79 | |
| TIGR03606 | 454 | non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH | 90.3 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 89.81 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 89.25 | |
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 87.99 | |
| KOG1214|consensus | 1289 | 87.95 | ||
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 86.74 | |
| COG4257 | 353 | Vgb Streptogramin lyase [Defense mechanisms] | 86.05 | |
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 85.85 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 85.67 | |
| PF07494 | 24 | Reg_prop: Two component regulator propeller; Inter | 85.64 | |
| KOG3342|consensus | 180 | 85.47 | ||
| COG2706 | 346 | 3-carboxymuconate cyclase [Carbohydrate transport | 85.37 | |
| TIGR02771 | 171 | TraF_Ti conjugative transfer signal peptidase TraF | 85.06 | |
| PF07995 | 331 | GSDH: Glucose / Sorbosone dehydrogenase; InterPro: | 84.69 | |
| TIGR02608 | 55 | delta_60_rpt delta-60 repeat domain. This domain o | 84.58 | |
| KOG1520|consensus | 376 | 83.79 | ||
| TIGR03118 | 336 | PEPCTERM_chp_1 conserved hypothetical protein TIGR | 83.29 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 83.1 | |
| PRK10276 | 139 | DNA polymerase V subunit UmuD; Provisional | 81.71 | |
| KOG4659|consensus | 1899 | 81.56 | ||
| PF03088 | 89 | Str_synth: Strictosidine synthase; InterPro: IPR01 | 80.92 | |
| PRK13838 | 176 | conjugal transfer pilin processing protease TraF; | 80.91 |
| >KOG1568|consensus | Back alignment and domain information |
|---|
Probab=99.52 E-value=8.5e-14 Score=101.11 Aligned_cols=95 Identities=25% Similarity=0.254 Sum_probs=70.7
Q ss_pred eeeee--EEEEEecceeeEEEeeeeecCccCCCCc----ccceEEeecccccCCCCCCCCCeEEEE-eCC-CCeEEeEec
Q psy15750 2 LVGIP--IGITFCDSIGYVARVDGTSMQPVCPSTY----MDTLYCSIEESESGTKRPISVDTVLTL-DKS-TGLLIDAWG 73 (115)
Q Consensus 2 ~~~~~--~~~~~~d~v~~~~~v~G~Sm~pt~~~~~----~D~~~~~~~~~~~~~~~~i~~~~I~vf-dp~-~G~~l~~~G 73 (115)
+.+++ +++||.|+|+++++|.|.||+||+|+.. .|+++.|+++. ++ +.+.+++|++| +|+ .++++.+..
T Consensus 15 ~~s~~~~v~~t~~DrV~~va~v~G~smqPtlnP~~~~~~~d~Vll~k~~v--~n-~~~~rGDiVvl~sP~~p~~~~iKRv 91 (174)
T KOG1568|consen 15 TGSLKWHVLLTFSDRVVHVAQVYGSSMQPTLNPTMNTNEKDTVLLRKWNV--KN-RKVSRGDIVVLKSPNDPDKVIIKRV 91 (174)
T ss_pred eeeeeeheeeeeeeeEEEEeEEecCcCCCccCCCcccccccEEEEEeecc--cc-ceeccCCEEEEeCCCChhheeeeee
Confidence 45566 7799999999999999999999999744 49999999999 44 77888999999 221 133333333
Q ss_pred CC-------CccCceeEEEccCCCEEEE-eCCCC
Q psy15750 74 KN-------KFYMPHGCTVDNKGFIWLT-DVALH 99 (115)
Q Consensus 74 ~g-------~f~~P~Gi~vd~~g~I~Vt-D~~~h 99 (115)
.+ .+..|+-+..-++|++||+ |+..|
T Consensus 92 ~alegd~~~t~~~k~~~v~vpkghcWVegDn~~h 125 (174)
T KOG1568|consen 92 AALEGDIMVTEDEKEEPVVVPKGHCWVEGDNQKH 125 (174)
T ss_pred ecccccEeccCCCCCCceecCCCcEEEecCCccc
Confidence 21 2445666677789999999 66555
|
|
| >KOG3567|consensus | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >TIGR02227 sigpep_I_bact signal peptidase I, bacterial type | Back alignment and domain information |
|---|
| >PRK10861 signal peptidase I; Provisional | Back alignment and domain information |
|---|
| >KOG0171|consensus | Back alignment and domain information |
|---|
| >COG0681 LepB Signal peptidase I [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >TIGR02754 sod_Ni_protease nickel-type superoxide dismutase maturation protease | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >cd06530 S26_SPase_I The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3 | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >PF00717 Peptidase_S24: Peptidase S24-like peptidase classification | Back alignment and domain information |
|---|
| >TIGR02228 sigpep_I_arch signal peptidase I, archaeal type | Back alignment and domain information |
|---|
| >KOG3567|consensus | Back alignment and domain information |
|---|
| >COG4257 Vgb Streptogramin lyase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller | Back alignment and domain information |
|---|
| >PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4499|consensus | Back alignment and domain information |
|---|
| >TIGR03032 conserved hypothetical protein TIGR03032 | Back alignment and domain information |
|---|
| >COG3386 Gluconolactonase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >cd06462 Peptidase_S24_S26 The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >COG3391 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 | Back alignment and domain information |
|---|
| >PF13449 Phytase-like: Esterase-like activity of phytase | Back alignment and domain information |
|---|
| >COG2932 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >cd06529 S24_LexA-like Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell | Back alignment and domain information |
|---|
| >TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain | Back alignment and domain information |
|---|
| >PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] | Back alignment and domain information |
|---|
| >PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 | Back alignment and domain information |
|---|
| >COG3204 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >COG4257 Vgb Streptogramin lyase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF07494 Reg_prop: Two component regulator propeller; InterPro: IPR011110 A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats | Back alignment and domain information |
|---|
| >KOG3342|consensus | Back alignment and domain information |
|---|
| >COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02771 TraF_Ti conjugative transfer signal peptidase TraF | Back alignment and domain information |
|---|
| >PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases | Back alignment and domain information |
|---|
| >TIGR02608 delta_60_rpt delta-60 repeat domain | Back alignment and domain information |
|---|
| >KOG1520|consensus | Back alignment and domain information |
|---|
| >TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PRK10276 DNA polymerase V subunit UmuD; Provisional | Back alignment and domain information |
|---|
| >KOG4659|consensus | Back alignment and domain information |
|---|
| >PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 | Back alignment and domain information |
|---|
| >PRK13838 conjugal transfer pilin processing protease TraF; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 115 | ||||
| 3fvz_A | 329 | Structure Of Peptidyl-Alpha-Hydroxyglycine Alpha-Am | 1e-11 |
| >pdb|3FVZ|A Chain A, Structure Of Peptidyl-Alpha-Hydroxyglycine Alpha-Amidating Lyase (Pal) Length = 329 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 1e-14 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 2e-05 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 4e-05 |
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 | Back alignment and structure |
|---|
Score = 67.1 bits (164), Expect = 1e-14
Identities = 27/56 (48%), Positives = 37/56 (66%)
Query: 48 GTKRPISVDTVLTLDKSTGLLIDAWGKNKFYMPHGCTVDNKGFIWLTDVALHQVFK 103
PI DT+L +D + ++ + GKN FY+PHG ++D G W+TDVALHQVFK
Sbjct: 61 RGLGPIEEDTILVIDPNNAEILQSSGKNLFYLPHGLSIDTDGNYWVTDVALHQVFK 116
|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Length = 286 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 99.07 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 98.83 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 98.62 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 98.62 | |
| 1b12_A | 248 | Signal peptidase I; serine proteinase, serine-depe | 98.61 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 98.57 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 98.53 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 98.49 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 98.47 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 98.37 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 98.36 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 98.28 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 98.25 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 98.23 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 98.23 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 98.23 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 98.21 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 98.16 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.15 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.14 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 98.12 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 98.11 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 98.1 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 98.06 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 98.03 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.03 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 98.03 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 98.03 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.03 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.02 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 97.99 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 97.97 | |
| 2p4o_A | 306 | Hypothetical protein; putative lactonase, structur | 97.96 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 97.94 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 97.94 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 97.92 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 97.87 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 97.87 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.87 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 97.83 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.81 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 97.81 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.73 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 97.72 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 97.7 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 97.7 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 97.64 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 97.63 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 97.62 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 97.6 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.56 | |
| 2fp8_A | 322 | Strictosidine synthase; six bladed beta propeller | 97.56 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 97.38 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 97.22 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 97.19 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 97.14 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 97.11 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 97.1 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 97.09 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 96.95 | |
| 3qqz_A | 255 | Putative uncharacterized protein YJIK; MCSG, PSI-2 | 96.63 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 96.56 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 96.39 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 96.0 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 96.0 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 95.84 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 95.61 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 95.58 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 95.5 | |
| 2p9w_A | 334 | MAL S 1 allergenic protein; beta propeller; 1.35A | 95.49 | |
| 3a9g_A | 354 | Putative uncharacterized protein; PQQ dependent de | 95.43 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 95.39 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 95.3 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 95.23 | |
| 2ism_A | 352 | Putative oxidoreductase; BL41XU spring-8, bladed b | 95.18 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 95.17 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 94.94 | |
| 3mbr_X | 243 | Glutamine cyclotransferase; beta-propeller; 1.44A | 94.85 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 94.79 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 94.63 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 94.45 | |
| 3sre_A | 355 | PON1, serum paraoxonase; directed evolution, 6-bla | 94.43 | |
| 1umu_A | 116 | UMUD'; induced mutagenesis, SOS mutagenesis, DNA r | 94.17 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 94.0 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 93.88 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 93.85 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 93.66 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 93.54 | |
| 3nok_A | 268 | Glutaminyl cyclase; beta-propeller, cyclotransfera | 93.35 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 92.99 | |
| 3nol_A | 262 | Glutamine cyclotransferase; beta-propeller, glutam | 92.99 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 92.45 | |
| 1kca_A | 109 | Repressor protein CI; gene regulation, DNA-binding | 92.25 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 92.21 | |
| 4a9v_A | 592 | PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona | 92.06 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 91.82 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 91.38 | |
| 2g8s_A | 353 | Glucose/sorbosone dehydrogenases; bladed beta-prop | 91.3 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 91.28 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 91.08 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 91.04 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 90.99 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 90.93 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 90.74 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 90.72 | |
| 3hxj_A | 330 | Pyrrolo-quinoline quinone; all beta protein. incom | 90.6 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 90.56 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 90.43 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 90.33 | |
| 1cru_A | 454 | Protein (soluble quinoprotein glucose dehydrogena; | 90.23 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 89.49 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 88.94 | |
| 1jhf_A | 202 | LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 | 88.84 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 88.79 | |
| 2hnf_A | 133 | Repressor protein CI101-229DM-K192A; viral protein | 88.69 | |
| 3s9j_A | 369 | Member of DUF4221 family; 6-bladed beta-propeller, | 88.18 | |
| 3das_A | 347 | Putative oxidoreductase; aldose sugar dehydrogenas | 87.85 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 87.75 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 87.64 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 87.64 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 87.55 | |
| 3q6k_A | 381 | 43.2 kDa salivary protein; beta propeller, binding | 87.36 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 85.94 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 85.77 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 85.66 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 85.52 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 85.12 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 85.1 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 85.04 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 84.63 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 83.23 |
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
Probab=99.07 E-value=4.1e-10 Score=85.08 Aligned_cols=94 Identities=31% Similarity=0.462 Sum_probs=71.1
Q ss_pred eEEEeeeeecCccCCCCcccceE-------EeecccccC-CCCCCCCCeEEEEeCCCCeEEeEecCCCccCceeEEEccC
Q psy15750 17 YVARVDGTSMQPVCPSTYMDTLY-------CSIEESESG-TKRPISVDTVLTLDKSTGLLIDAWGKNKFYMPHGCTVDNK 88 (115)
Q Consensus 17 ~~~~v~G~Sm~pt~~~~~~D~~~-------~~~~~~~~~-~~~~i~~~~I~vfdp~~G~~l~~~G~g~f~~P~Gi~vd~~ 88 (115)
++.++.|++++|..+....|... +.....|.. ...++..+.|.++|+++|+++..++.+.+..|+|+++|++
T Consensus 22 ~l~~v~~va~d~~G~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~g~~~~~~~~~~~~~p~gia~d~~ 101 (329)
T 3fvz_A 22 LPGQVSGVALDSKNNLVIFHRGDHVWDGNSFDSKFVYQQRGLGPIEEDTILVIDPNNAEILQSSGKNLFYLPHGLSIDTD 101 (329)
T ss_dssp CCSCEEEEEECTTCCEEEEECTTCCCCTTSBCTTSCBSCGGGCSCCSCCEEEECTTTCCEEEEECTTTCSSEEEEEECTT
T ss_pred ecCCceEEEECCCCCEEEEeCCCCeEEeeccCcceeecccccccccCCcEEEEECCCCeEEeccCCCccCCceEEEECCC
Confidence 45678889999887754322111 111111111 2346677899999997799999999999999999999999
Q ss_pred CCEEEEeCCCCEEEEeCCCCCC
Q psy15750 89 GFIWLTDVALHQVFKTPYTYNF 110 (115)
Q Consensus 89 g~I~VtD~~~h~V~~f~~~G~f 110 (115)
|++||+|..+++|++|+++|+.
T Consensus 102 g~l~v~d~~~~~v~~~~~~g~~ 123 (329)
T 3fvz_A 102 GNYWVTDVALHQVFKLDPHSKE 123 (329)
T ss_dssp SCEEEEETTTTEEEEECTTCSS
T ss_pred CCEEEEECCCCEEEEEeCCCCe
Confidence 9999999999999999999974
|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1b12_A Signal peptidase I; serine proteinase, serine-dependant hydrolase, signal peptid processing, protein translocation; HET: 1PN; 1.95A {Escherichia coli} SCOP: b.87.1.2 PDB: 3s04_A* 1t7d_A* 3iiq_A* 1kn9_A* | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* | Back alignment and structure |
|---|
| >1umu_A UMUD'; induced mutagenesis, SOS mutagenesis, DNA repair, beta- lactamase cleavage reaction, LEXA repressor, lambda CI; 2.50A {Escherichia coli} SCOP: b.87.1.1 PDB: 1i4v_A 1ay9_A | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1kca_A Repressor protein CI; gene regulation, DNA-binding, lambda repressor, protein oligomerization, DNA-looping; 2.91A {Enterobacteria phage lambda} SCOP: b.87.1.1 | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2hnf_A Repressor protein CI101-229DM-K192A; viral protein; 1.80A {Escherichia coli} PDB: 2ho0_A 1f39_A | Back alignment and structure |
|---|
| >3s9j_A Member of DUF4221 family; 6-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.75A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 99.09 | |
| d1q7fa_ | 279 | Brain tumor cg10719-pa {Fruit fly (Drosophila mela | 98.89 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 98.87 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 98.79 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 98.42 | |
| d1b12a_ | 247 | Type 1 signal peptidase {Escherichia coli [TaxId: | 98.36 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 97.89 | |
| d2dg1a1 | 319 | Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 | 97.81 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 97.65 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 97.62 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 97.52 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 97.51 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 97.36 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 97.33 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 97.31 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 97.3 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 96.97 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 96.67 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 96.58 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 96.34 | |
| d1v04a_ | 340 | Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory | 94.4 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 93.01 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 92.62 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 92.3 | |
| d1jhfa2 | 126 | LexA C-terminal domain {Escherichia coli [TaxId: 5 | 91.53 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 91.42 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 91.39 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 90.66 | |
| d2ghsa1 | 295 | Regucalcin {Agrobacterium tumefaciens [TaxId: 358] | 90.58 | |
| d1f39a_ | 101 | lambda repressor C-terminal domain {Bacteriophage | 90.46 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 89.74 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 89.5 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 89.42 | |
| d1umua_ | 105 | UmuD' {Escherichia coli [TaxId: 562]} | 87.89 | |
| d1jofa_ | 365 | 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu | 84.52 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 84.27 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 83.38 | |
| d1crua_ | 450 | Soluble quinoprotein glucose dehydrogenase {Acinet | 82.53 |
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: NHL repeat family: NHL repeat domain: Brain tumor cg10719-pa species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.09 E-value=1.2e-10 Score=84.89 Aligned_cols=55 Identities=15% Similarity=0.184 Sum_probs=50.1
Q ss_pred CCeEEEEeCCCCeEEeEec-CCCccCceeEEEccCCCEEEEeCC-CCEEEEeCCCCCC
Q psy15750 55 VDTVLTLDKSTGLLIDAWG-KNKFYMPHGCTVDNKGFIWLTDVA-LHQVFKTPYTYNF 110 (115)
Q Consensus 55 ~~~I~vfdp~~G~~l~~~G-~g~f~~P~Gi~vd~~g~I~VtD~~-~h~V~~f~~~G~f 110 (115)
.+.|.+||+ +|+++.++| .+.+..|+||++|++|+|||+|.. +++|.+|+++|++
T Consensus 177 ~~~V~~~d~-~G~~~~~~g~~g~~~~P~giavD~~G~i~Vad~~~~~~v~~f~~~G~~ 233 (279)
T d1q7fa_ 177 AHCVKVFNY-EGQYLRQIGGEGITNYPIGVGINSNGEILIADNHNNFNLTIFTQDGQL 233 (279)
T ss_dssp GTEEEEEET-TCCEEEEESCTTTSCSEEEEEECTTCCEEEEECSSSCEEEEECTTSCE
T ss_pred ccceeeeec-CCceeeeecccccccCCcccccccCCeEEEEECCCCcEEEEECCCCCE
Confidence 478999999 999999998 478999999999999999999976 5689999999986
|
| >d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1b12a_ b.87.1.2 (A:) Type 1 signal peptidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jhfa2 b.87.1.1 (A:73-198) LexA C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1f39a_ b.87.1.1 (A:) lambda repressor C-terminal domain {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1umua_ b.87.1.1 (A:) UmuD' {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|