Diaphorina citri psyllid: psy15771

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----

MLRNALRCSVALRGALMSMPSKHMRLMTTAATTANTTEARPTIRKPIDEVARSHLVDFGKYCAEILPKYIEKVQITSGDELELLIIPEGVVPVLQFLKDHHTAQFVNLVDIAGMDVPSRPNRFEIIYNLLSLRYNSRIRVKTYTDELTPLDSANEVFKAANWYEREIWDMFGVYFSNHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEKKRVVVEPLELAQEFRKFQLETPWEQFPNFRNTPGSSGSEEIPLDEKKEEEKK

cHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEcccccHHHHHHHHcccccccccccccEEECcccccccEEEEEEccccccccEEEEEEEccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccEEEcccccccEEEccccccHHHHccccccccccccccccccccccccccccccccHHccc

********************************************KPIDEVARSHLVDFGKYCAEILPKYIEKVQITSGDELELLIIPEGVVPVLQFLKDHHTAQFVNLVDIAGMDVPSRPNRFEIIYNLLSLRYNSRIRVKTYTDELTPLDSANEVFKAANWYEREIWDMFGVYFSNHPDLRRILTDYGFEGHPFRKDFPLSGYVEVRYDDEKKRVVVEPLELAQEFRKFQLETPWEQFPNFRN*********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.	very confident	Q0MQG8
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.	very confident	O75489
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial	Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.	very confident	Q9DCT2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031966 [CC]	mitochondrial membrane	confident	GO:0005737, GO:0005575, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0031967, GO:0031975, GO:0044446, GO:0005740, GO:0005739, GO:0044429, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044281 [BP]	small molecule metabolic process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0005747 [CC]	mitochondrial respiratory chain complex I	probable	GO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045271, GO:0032991, GO:0043231, GO:0030964, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0030308 [BP]	negative regulation of cell growth	probable	GO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0008137 [MF]	NADH dehydrogenase (ubiquinone) activity	probable	GO:0003824, GO:0016655, GO:0050136, GO:0016651, GO:0003674, GO:0003954, GO:0016491
GO:0072593 [BP]	reactive oxygen species metabolic process	probable	GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0006917 [BP]	induction of apoptosis	probable	GO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006120 [BP]	mitochondrial electron transport, NADH to ubiquinone	probable	GO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0009055 [MF]	electron carrier activity	probable	GO:0003674

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.6.-.-	Acting on NADH or NADPH.	probable
1.6.99.-	With other acceptors.	probable
1.6.5.-	With a quinone or similar compound as acceptor.	probable
1.6.5.3	NADH:ubiquinone reductase (H(+)-translocating).	probable
1.6.99.3	Transferred entry: 1.6.99.3.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MCR, chain A
Confidence level:very confident
Coverage over the Query: 48-182
View the alignment between query and template
View the model in PyMOL

Template: 3I9V, chain 5
Confidence level:very confident
Coverage over the Query: 78-209
View the alignment between query and template
View the model in PyMOL