Diaphorina citri psyllid: psy15775


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MMRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRHKIN
cccccccccccccccccccccHHHHcccccHHHHHHHHHHcccccccccccccccccccccEEccccEEEccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccEEECcccccccEEEccEEEEcccccEEEEEEccccc
MMRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRHKIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome P450 4V2 Catalyzes the omega-hydroxylation of medium-chain saturated fatty acids such as laurate, myristate and palmitate in an NADPH-dependent pathway. The substrate specificity is higher for myristate > laurate > palmitate (C14>C16>C12).confidentA2RRT9
Cytochrome P450 4V2 Catalyzes the omega-hydroxylation of medium-chain saturated fatty acids such as laurate, myristate and palmitate in an NADPH-dependent pathway. The substrate specificity is higher for myristate > laurate > palmitate (C14>C16>C12).confidentQ9DBW0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046483 [BP]heterocycle metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0070989 [BP]oxidative demethylationprobableGO:0070988, GO:0044710, GO:0008150, GO:0008152, GO:0055114
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0008289 [MF]lipid bindingprobableGO:0003674, GO:0005488
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0019373 [BP]epoxygenase P450 pathwayprobableGO:0044238, GO:0006631, GO:0008152, GO:0006082, GO:0071704, GO:1901568, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0006690, GO:0019369, GO:0044237, GO:0043436, GO:0001676, GO:0008150, GO:0044255, GO:0033559, GO:0044281, GO:0006629
GO:0043651 [BP]linoleic acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0043436, GO:0008150, GO:0019752, GO:0008152, GO:0001676, GO:0044255, GO:0033559, GO:0044281
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008392 [MF]arachidonic acid epoxygenase activityprobableGO:0004497, GO:0016705, GO:0003824, GO:0003674, GO:0008391, GO:0016491
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0006721 [BP]terpenoid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006720, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255
GO:0018685 [MF]alkane 1-monooxygenase activityprobableGO:0004497, GO:0016705, GO:0016713, GO:0003824, GO:0003674, GO:0016491
GO:1901575 [BP]organic substance catabolic processprobableGO:0008150, GO:0071704, GO:0009056, GO:0008152
GO:0048252 [BP]lauric acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0044237, GO:0008152, GO:0043436, GO:0044255, GO:0051791, GO:0044281
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0017144 [BP]drug metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DBG, chain A
Confidence level:very confident
Coverage over the Query: 64-126,137-188
View the alignment between query and template
View the model in PyMOL
Template: 3S79, chain A
Confidence level:very confident
Coverage over the Query: 17-126,137-188
View the alignment between query and template
View the model in PyMOL