Psyllid ID: psy15775

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MMRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRHKIN
cccccccccccccccccccccHHHHcccccHHHHHHHHHHcccccccccccccccccccccEEccccEEEccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccEEEEcccccccEEEccEEEEcccccEEEEEEccccc
ccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccHEEEHEEccccccccEEEccccEEccccEEEEEEEEccccccccccccccccHccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEccccccccccccEEEEEccccEEEEEEEccccc
mmrpwlwpslifgltrdgkrhEENLKILHGFTRRVIEERKAARaaggvregndldenfgepiLTAREYLLPVGCMLNIEIVslhrcadqypnpevfqpdnflpenvqkrhnysyipfsagprncigEVVEDIIYESQKFALLEEKCVLASILRKFKVIsleklddvTIMIDLIlrpasgvkvkleprhkin
MMRPWLWPSLIfgltrdgkrHEENLKilhgftrrVIEERKAAraaggvregndldenfgEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKvisleklddvtimidlilrpasgvkvkleprhkin
MMRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRHKIN
****WLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVR*GNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGV***********
MMRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRH***
MMRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRHKIN
*MRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMRPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGGVREGNDLDENFGEPILTAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRHKIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
P29981511 Cytochrome P450 4C1 OS=Bl N/A N/A 0.581 0.217 0.636 2e-39
Q9VA27535 Cytochrome P450 4c3 OS=Dr yes N/A 0.570 0.203 0.487 3e-28
A2RRT9525 Cytochrome P450 4V2 OS=Ra yes N/A 0.513 0.186 0.509 5e-25
Q9DBW0525 Cytochrome P450 4V2 OS=Mu yes N/A 0.513 0.186 0.509 8e-25
Q6ZWL3525 Cytochrome P450 4V2 OS=Ho yes N/A 0.507 0.184 0.495 7e-24
Q5RCN6525 Cytochrome P450 4V2 OS=Po yes N/A 0.502 0.182 0.5 8e-24
Q9VYY4574 Cytochrome P450 4g15 OS=D no N/A 0.602 0.200 0.408 4e-23
Q964T1501 Cytochrome P450 4c21 OS=B N/A N/A 0.581 0.221 0.413 1e-22
Q9VMS8511 Probable cytochrome P450 no N/A 0.570 0.213 0.420 3e-22
Q9VMS9509 Probable cytochrome P450 no N/A 0.581 0.218 0.421 4e-22
>sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 93/121 (76%), Gaps = 10/121 (8%)

Query: 67  EYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIG 126
           +YL+P GCM+N++I  +HR  DQYPNPE F PDNFLPE V KRH Y+Y+PFSAGPRNCIG
Sbjct: 395 DYLVPAGCMMNLQIYHVHRNQDQYPNPEAFNPDNFLPERVAKRHPYAYVPFSAGPRNCIG 454

Query: 127 EVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEP 186
                     QKFA LEEK VL+SILR FKV S+EK +D+T+M +LILRP SG+KV+L P
Sbjct: 455 ----------QKFATLEEKTVLSSILRNFKVRSIEKREDLTLMNELILRPESGIKVELIP 504

Query: 187 R 187
           R
Sbjct: 505 R 505
Involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Blaberus discoidalis (taxid: 6981)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 4EC: .EC: 1
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function description
>sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 Back     alignment and function description
>sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 Back     alignment and function description
>sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 Back     alignment and function description
>sp|Q9VMS8|C4AC2_DROME Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 Back     alignment and function description
>sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
231885 511 RecName: Full=Cytochrome P450 4C1; AltNa 0.581 0.217 0.636 1e-37
189178724 502 cytochrome P450 [Nilaparvata lugens] 0.591 0.225 0.585 1e-36
408724215 520 cytochrome P450 CYP4C62 [Laodelphax stri 0.586 0.215 0.581 5e-36
189178726 520 cytochrome P450 [Nilaparvata lugens] 0.586 0.215 0.573 6e-36
339896241 509 cytochrome P450 [Bemisia tabaci] 0.575 0.216 0.575 4e-34
399631520 510 cytochrome P450 [Bemisia tabaci] 0.575 0.215 0.566 7e-34
383464622 514 cytochrome P450 4C [Portunus tritubercul 0.575 0.214 0.541 1e-28
195061194 542 GH14221 [Drosophila grimshawi] gi|193891 0.575 0.202 0.516 1e-28
392612327 515 cytochrome P450 [Exopalaemon carinicauda 0.575 0.213 0.558 2e-28
195113187 533 GI22127 [Drosophila mojavensis] gi|19391 0.575 0.206 0.516 2e-28
>gi|231885|sp|P29981.1|CP4C1_BLADI RecName: Full=Cytochrome P450 4C1; AltName: Full=CYPIVC1 gi|155947|gb|AAA27819.1| cytochrome P450 [Blaberus discoidalis] Back     alignment and taxonomy information
 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/121 (63%), Positives = 93/121 (76%), Gaps = 10/121 (8%)

Query: 67  EYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIG 126
           +YL+P GCM+N++I  +HR  DQYPNPE F PDNFLPE V KRH Y+Y+PFSAGPRNCIG
Sbjct: 395 DYLVPAGCMMNLQIYHVHRNQDQYPNPEAFNPDNFLPERVAKRHPYAYVPFSAGPRNCIG 454

Query: 127 EVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEP 186
                     QKFA LEEK VL+SILR FKV S+EK +D+T+M +LILRP SG+KV+L P
Sbjct: 455 ----------QKFATLEEKTVLSSILRNFKVRSIEKREDLTLMNELILRPESGIKVELIP 504

Query: 187 R 187
           R
Sbjct: 505 R 505

Source: Blaberus discoidalis

Species: Blaberus discoidalis

Genus: Blaberus

Family: Blaberidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189178724|emb|CAQ57674.1| cytochrome P450 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|408724215|gb|AFU86425.1| cytochrome P450 CYP4C62 [Laodelphax striatella] Back     alignment and taxonomy information
>gi|189178726|emb|CAQ57675.1| cytochrome P450 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|339896241|gb|AEK21806.1| cytochrome P450 [Bemisia tabaci] Back     alignment and taxonomy information
>gi|399631520|gb|AFP49818.1| cytochrome P450 [Bemisia tabaci] Back     alignment and taxonomy information
>gi|383464622|gb|AFH35031.1| cytochrome P450 4C [Portunus trituberculatus] Back     alignment and taxonomy information
>gi|195061194|ref|XP_001995943.1| GH14221 [Drosophila grimshawi] gi|193891735|gb|EDV90601.1| GH14221 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|392612327|gb|AFM82473.1| cytochrome P450 [Exopalaemon carinicauda] Back     alignment and taxonomy information
>gi|195113187|ref|XP_002001150.1| GI22127 [Drosophila mojavensis] gi|193917744|gb|EDW16611.1| GI22127 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
FB|FBgn0015032535 Cyp4c3 "Cytochrome P450-4c3" [ 0.570 0.203 0.487 2.1e-34
UNIPROTKB|F1N3Z7527 CYP4V2 "Uncharacterized protei 0.554 0.201 0.465 6.1e-33
ZFIN|ZDB-GENE-061103-88510 cyp4v7 "cytochrome P450, famil 0.586 0.219 0.459 5e-32
UNIPROTKB|E1BYW5530 CYP4V2 "Uncharacterized protei 0.586 0.211 0.442 3.2e-31
MGI|MGI:2142763525 Cyp4v3 "cytochrome P450, famil 0.513 0.186 0.509 4.6e-31
UNIPROTKB|Q5RCN6525 CYP4V2 "Cytochrome P450 4V2" [ 0.502 0.182 0.5 2.2e-30
ZFIN|ZDB-GENE-061103-601513 cyp4v8 "cytochrome P450, famil 0.575 0.214 0.425 1e-29
WB|WBGene00021200495 cyp-31A3 [Caenorhabditis elega 0.581 0.224 0.396 3.5e-29
WB|WBGene00010354495 cyp-31A2 [Caenorhabditis elega 0.581 0.224 0.388 9.6e-29
FB|FBgn0031693509 Cyp4ac1 "Cyp4ac1" [Drosophila 0.581 0.218 0.421 2.5e-26
FB|FBgn0015032 Cyp4c3 "Cytochrome P450-4c3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 301 (111.0 bits), Expect = 2.1e-34, Sum P(2) = 2.1e-34
 Identities = 58/119 (48%), Positives = 83/119 (69%)

Query:    69 LLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEV 128
             ++P G    I   +LHR    +P PE F PDNFLPEN   RH ++YIPFSAGPRNCIG  
Sbjct:   426 IVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIG-- 483

Query:   129 VEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPR 187
                     QKFA+LEEK V++++LRK+K+ ++++ +D+T++ +LILRP  G++VK+ PR
Sbjct:   484 --------QKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPR 534
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;NAS
GO:0016020 "membrane" evidence=NAS
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
UNIPROTKB|F1N3Z7 CYP4V2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-88 cyp4v7 "cytochrome P450, family 4, subfamily V, polypeptide 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYW5 CYP4V2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2142763 Cyp4v3 "cytochrome P450, family 4, subfamily v, polypeptide 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RCN6 CYP4V2 "Cytochrome P450 4V2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-601 cyp4v8 "cytochrome P450, family 4, subfamily V, polypeptide 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00021200 cyp-31A3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00010354 cyp-31A2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0031693 Cyp4ac1 "Cyp4ac1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2RRT9CP4V2_RAT1, ., 1, 4, ., 1, 3, ., -0.50920.51300.1866yesN/A
Q9DBW0CP4V2_MOUSE1, ., 1, 4, ., 1, 3, ., -0.50920.51300.1866yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
pfam00067461 pfam00067, p450, Cytochrome P450 3e-27
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-14
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-11
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 4e-11
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-10
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 2e-08
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 8e-06
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 9e-06
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 1e-05
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-05
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 0.001
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 0.002
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score =  106 bits (266), Expect = 3e-27
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 11/120 (9%)

Query: 66  REYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCI 125
             YL+P G ++ + + +LHR  + +PNPE F P+ FL EN + R +++++PF AGPRNC+
Sbjct: 352 PGYLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGAGPRNCL 411

Query: 126 GEVVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMI-DLILRPASGVKVKL 184
           GE          + A +E K  LA++L+ F+V      D   I     +L P    K+K 
Sbjct: 412 GE----------RLARMEMKLFLATLLQNFEVELPPGTDPPDIDETPGLLLPPKPYKLKF 461

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
KOG0157|consensus497 99.98
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.97
KOG0159|consensus519 99.96
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.96
PLN03234499 cytochrome P450 83B1; Provisional 99.95
KOG0156|consensus489 99.95
PLN02290516 cytokinin trans-hydroxylase 99.95
KOG0158|consensus499 99.95
PLN02655466 ent-kaurene oxidase 99.95
PLN02738633 carotene beta-ring hydroxylase 99.95
PLN02936489 epsilon-ring hydroxylase 99.95
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.95
PLN00168519 Cytochrome P450; Provisional 99.95
PLN02971543 tryptophan N-hydroxylase 99.95
PLN02500490 cytochrome P450 90B1 99.95
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.95
PTZ00404482 cytochrome P450; Provisional 99.95
PLN02183516 ferulate 5-hydroxylase 99.94
PLN02987472 Cytochrome P450, family 90, subfamily A 99.94
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.94
PLN02687517 flavonoid 3'-monooxygenase 99.94
PLN02774463 brassinosteroid-6-oxidase 99.94
PLN03018534 homomethionine N-hydroxylase 99.94
PLN03112514 cytochrome P450 family protein; Provisional 99.94
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.93
PLN02302490 ent-kaurenoic acid oxidase 99.93
PLN02196463 abscisic acid 8'-hydroxylase 99.93
PLN02394503 trans-cinnamate 4-monooxygenase 99.93
KOG0684|consensus486 99.92
PLN02966502 cytochrome P450 83A1 99.91
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.88
PLN02648480 allene oxide synthase 99.77
>KOG0157|consensus Back     alignment and domain information 
Probab=99.98  E-value=1.5e-31  Score=239.18  Aligned_cols=173  Identities=40%  Similarity=0.724  Sum_probs=144.1

Q ss_pred             CCccchhhhccCCcchHHHHHHHHHHHHHHHHHHHHHHHHHhcCC----C---------------C--------------
Q psy15775          3 RPWLWPSLIFGLTRDGKRHEENLKILHGFTRRVIEERKAARAAGG----V---------------R--------------   49 (191)
Q Consensus         3 ~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iI~~rr~~~~~~~----~---------------~--------------   49 (191)
                      .|+ +..+++.+. ..++..++.+.+++++.++|++||++....+    .               .              
T Consensus       223 ~p~-~~~~~~~~~-~~~~~~~a~~~~~~~~~~iI~~rr~~~~~~~~~~~~~~~d~L~~~~~~~~~~l~~~~i~d~v~tf~  300 (497)
T KOG0157|consen  223 LPL-GTKFLYGLK-SERKLKKARKILHDFLEKIIRERREELEKEGSGEEKKRLDFLDTLLLEEDKPLTDEDIRDEVDTFM  300 (497)
T ss_pred             Cch-hhhHHhhcc-hHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccchhhhHHHHHHHhccCCCCHHHHHHHHHHhe
Confidence            454 445555455 7899999999999999999999997643211    0               0              


Q ss_pred             -CC--------------------------cccccccCCC-------------eE-------------------------E
Q psy15775         50 -EG--------------------------NDLDENFGEP-------------IL-------------------------T   64 (191)
Q Consensus        50 -aG--------------------------~Ei~~~~~~~-------------~i-------------------------~   64 (191)
                       ||                          +|+++++|+.             |+                         +
T Consensus       301 faG~DTTss~ltw~l~~La~hP~vq~k~~eEi~~i~~~~~~~~~~~~~~~m~yl~~vi~EsLRLyppvp~~~R~~~~d~~  380 (497)
T KOG0157|consen  301 FAGHDTTSSALTWTLWLLAKHPEVQEKLREEVDEILGNRDDKWEVEKLDQMKYLEMVIKESLRLYPPVPLVARKATKDVK  380 (497)
T ss_pred             eeccchHHHHHHHHHHHHhcCHHHHHHHHHHHHHHhCCCCCCCChhhhhhhHHHHHHHHHHhccCCCCchhhcccCCCeE
Confidence             45                          8888888732             00                         6


Q ss_pred             E-cCEEeCCCCEEEeehhhhcCCCCCCC-CCCCcCCCCCCCcccc-CCCCceeecCCCCCCccccccccchhhHHHHHHH
Q psy15775         65 A-REYLLPVGCMLNIEIVSLHRCADQYP-NPEVFQPDNFLPENVQ-KRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFAL  141 (191)
Q Consensus        65 ~-~g~~ip~gt~v~~~~~~~~~~~~~~~-~p~~F~P~R~l~~~~~-~~~~~~~~pFg~G~r~C~G~~~~~~~~~~~~~A~  141 (191)
                      + +||.||||+.|.+++|++|||+.+|+ ||++||||||+++... ..++++|+|||+|+|.|+|          ++||+
T Consensus       381 l~~g~~IPkG~~V~i~~~~~~r~~~~~~~dp~~F~PeRf~~~~~~~~~~~~~fipFsaGpR~CiG----------~~fA~  450 (497)
T KOG0157|consen  381 LPGGYTIPKGTNVLISIYALHRDPRVWGEDPEEFDPERFLDGEEKAKRHPFAFIPFSAGPRNCIG----------QKFAM  450 (497)
T ss_pred             cCCCcEeCCCCEEEEehHHhccCccccCCChhhcCccccCCCCCcCCCCCccccCCCCCcccchh----------HHHHH
Confidence            7 58999999999999999999999996 9999999999965433 5678999999999999999          99999


Q ss_pred             HHHHHHHHHHhhhCEEEecCCCCCeeEeeeEEEeeCCCceEEEEEcc
Q psy15775        142 LEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPRH  188 (191)
Q Consensus       142 ~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R~  188 (191)
                      +|||++++.|+++|++++..+.. ......++++|+.+++|++++|.
T Consensus       451 lemKv~l~~ll~~f~~~~~~~~~-~~~~~~~~l~~~~gl~v~~~~r~  496 (497)
T KOG0157|consen  451 LEMKVVLAHLLRRFRIEPVGGDK-PKPVPELTLRPKNGLKVKLRPRG  496 (497)
T ss_pred             HHHHHHHHHHHHheEEEecCCCC-ceeeeEEEEEecCCeEEEEEeCC
Confidence            99999999999999999876543 67788999999999999999996

>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 7e-10
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 7e-10
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-09
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 4e-09
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 4e-09
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 4e-09
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-08
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-08
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 3e-08
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-07
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 1e-07
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-07
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-07
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 1e-07
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 8e-07
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-06
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 1e-06
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 1e-06
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 2e-06
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 2e-06
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 2e-06
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 5e-06
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-05
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 2e-05
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-05
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-05
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 3e-05
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-05
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-05
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 7e-05
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 8e-05
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 8e-05
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-04
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 2e-04
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 4e-04
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 5e-04
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 8e-04
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 51/95 (53%), Gaps = 10/95 (10%)
Query: 66  REYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCI 125
           R YL+P G  + I + S+     ++PNPE+F P +FL E    + +  ++PFSAG R C+
Sbjct: 358 RNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFKKSKYFMPFSAGKRICV 417
Query: 126 GEVVEDIIYESQKFALLEEKCVLASILRKFKVISL 160
           GE +          A +E    L SIL+ F + SL
Sbjct: 418 GEAL----------AGMELFLFLTSILQNFNLKSL 442
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-42
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-10
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 7e-37
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 5e-10
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-36
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 1e-04
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-34
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 6e-31
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-30
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-30
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-07
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-30
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 3e-30
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 5e-30
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-29
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-05
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 6e-28
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-26
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-26
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-24
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-23
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 4e-20
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-19
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-18
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 1e-13
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-13
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-12
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-12
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-12
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-11
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-11
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-10
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-10
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-10
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  146 bits (372), Expect = 1e-42
 Identities = 33/121 (27%), Positives = 50/121 (41%), Gaps = 13/121 (10%)

Query: 68  YLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGE 127
             +P    L      + R    + +P  F PD F P     +  ++Y PFS G R+CIG 
Sbjct: 335 VRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA--PKPRFTYFPFSLGHRSCIG- 391

Query: 128 VVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLDDVTIMIDLILRPASGVKVKLEPR 187
                    Q+FA +E K V+A +L++ +   L       +     L+P   V   L PR
Sbjct: 392 ---------QQFAQMEVKVVMAKLLQRLEF-RLVPGQRFGLQEQATLKPLDPVLCTLRPR 441

Query: 188 H 188
            
Sbjct: 442 G 442
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.97
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.97
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.97
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.97
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.96
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.96
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.96
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.96
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.96
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.96
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.96
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.96
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.95
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.95
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.95
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.95
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.95
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.95
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.95
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.95
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.94
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.93
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.92
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.91
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.91
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.91
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.91
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.91
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.91
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.9
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.9
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.9
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.9
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.9
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.9
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.9
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.9
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.9
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.9
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.9
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.9
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.9
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.9
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.89
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.89
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.89
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.89
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.89
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.89
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.89
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.89
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.89
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.89
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.88
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.88
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.88
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.88
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.88
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.88
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.88
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.88
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.88
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.88
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.88
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.87
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.87
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.87
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.87
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.87
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.87
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.86
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.85
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.84
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.82
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.82
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.81
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.97  E-value=6.5e-32  Score=234.62  Aligned_cols=115  Identities=23%  Similarity=0.422  Sum_probs=102.2

Q ss_pred             EEcCEEeCCCCEEEeehhhhcCCCCCCCCCCCcCCCCCCCccccCCCCceeecCCCCCCccccccccchhhHHHHHHHHH
Q psy15775         64 TAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLE  143 (191)
Q Consensus        64 ~~~g~~ip~gt~v~~~~~~~~~~~~~~~~p~~F~P~R~l~~~~~~~~~~~~~pFg~G~r~C~G~~~~~~~~~~~~~A~~e  143 (191)
                      +++||.||+||.|+++.|++||||++|+||++|+||||++++....++.+|+|||+|+|.|+|          ++||++|
T Consensus       361 ~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~R~C~G----------~~lA~~e  430 (479)
T 3tbg_A          361 EVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLG----------EPLARME  430 (479)
T ss_dssp             EETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCBCCCTTCCTTCCSTTSCTT----------HHHHHHH
T ss_pred             eECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcccCCCCceecCCCCCcCChh----------HHHHHHH
Confidence            789999999999999999999999999999999999999887777778899999999999999          9999999


Q ss_pred             HHHHHHHHhhhCEEEecCCCC--CeeEeeeEEEeeCCCceEEEEEccC
Q psy15775        144 EKCVLASILRKFKVISLEKLD--DVTIMIDLILRPASGVKVKLEPRHK  189 (191)
Q Consensus       144 ~~~~la~ll~~f~~~~~~~~~--~~~~~~~~~~~p~~~~~v~~~~R~~  189 (191)
                      |++++|.||++|+|+++++..  ......++++.|+ +++|++++|++
T Consensus       431 ~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P~-~~~v~~~pRs~  477 (479)
T 3tbg_A          431 LFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPS-PYELCAVPRHH  477 (479)
T ss_dssp             HHHHHHHHHHHEEEECCTTSCCCCSCEEESSSEEEC-CCCBEEEEC--
T ss_pred             HHHHHHHHHHccEEEeCCCCCCccccccceeeecCC-CeEEEEEECCC
Confidence            999999999999999875532  2344556788887 89999999986
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 7e-28
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-25
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 3e-25
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-24
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-22
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 4e-19
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 5e-19
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 3e-18
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-18
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 4e-18
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-17
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 6e-16
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-15
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 9e-15
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 5e-14
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 5e-14
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-13
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 4e-13
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 9e-13
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-12
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-12
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  106 bits (265), Expect = 7e-28
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 11/121 (9%)

Query: 68  YLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGE 127
             +P G ++ I   +LHR    +  PE F P+ F  +N      Y Y PF +GPRNCIG 
Sbjct: 359 MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG- 417

Query: 128 VVEDIIYESQKFALLEEKCVLASILRKFKVISLEKLD-DVTIMIDLILRPASGVKVKLEP 186
                     +FAL+  K  L  +L+ F     ++    + + +  +L+P   V +K+E 
Sbjct: 418 ---------MRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVES 468

Query: 187 R 187
           R
Sbjct: 469 R 469
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.97
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.97
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.96
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.96
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.96
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.95
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.94
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.91
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.91
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.91
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.91
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.9
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.9
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.89
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.89
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.89
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.88
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.87
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.87
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.86
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.85
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=6.7e-32  Score=228.56  Aligned_cols=114  Identities=27%  Similarity=0.508  Sum_probs=103.1

Q ss_pred             EEcCEEeCCCCEEEeehhhhcCCCCCCCCCCCcCCCCCCCccccCCCCceeecCCCCCCccccccccchhhHHHHHHHHH
Q psy15775         64 TAREYLLPVGCMLNIEIVSLHRCADQYPNPEVFQPDNFLPENVQKRHNYSYIPFSAGPRNCIGEVVEDIIYESQKFALLE  143 (191)
Q Consensus        64 ~~~g~~ip~gt~v~~~~~~~~~~~~~~~~p~~F~P~R~l~~~~~~~~~~~~~pFg~G~r~C~G~~~~~~~~~~~~~A~~e  143 (191)
                      +++|+.|||||.|+++.+++|+|+++|+||++|+||||++++.....+..|+|||+|+|.|+|          ++||++|
T Consensus       349 ~~~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G----------~~~A~~~  418 (463)
T d3czha1         349 VVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAKKEALVPFSLGRRHCLG----------EHLARME  418 (463)
T ss_dssp             EETTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBCTTSCBCCCTTCCTTCCSTTCCTT----------HHHHHHH
T ss_pred             ccCCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCCCccccCCCCceeCCCCCCcCCch----------HHHHHHH
Confidence            789999999999999999999999999999999999999887766777889999999999999          9999999


Q ss_pred             HHHHHHHHhhhCEEEecCCC-CCeeEeeeEEEeeCCCceEEEEEcc
Q psy15775        144 EKCVLASILRKFKVISLEKL-DDVTIMIDLILRPASGVKVKLEPRH  188 (191)
Q Consensus       144 ~~~~la~ll~~f~~~~~~~~-~~~~~~~~~~~~p~~~~~v~~~~R~  188 (191)
                      +++++|.||++|+|++.++. .+.....++++.|+ ++.|++++|+
T Consensus       419 ~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p~-~~~v~~~~R~  463 (463)
T d3czha1         419 MFLFFTALLQRFHLHFPHELVPDLKPRLGMTLQPQ-PYLICAERRH  463 (463)
T ss_dssp             HHHHHHHHHHHEEEECGGGCCCCCCCCSSSSCCCC-CCCBEEEECC
T ss_pred             HHHHHHHHHHhcEEEeCCCCCCCceeccCeEEecc-CcEEEEEeCc
Confidence            99999999999999986543 24566677888887 7899999995
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure