Diaphorina citri psyllid: psy157


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MVDYSKWKDIEISDDEDETHPNIDTPSLFRWRHQARVERMEEQRLENEKFQQEKEKTLKTLEETKKKLVESEQAGANNLDELKKALAELEKEAANIRKKEEDLKKKEKITPWNVDTISKPGFTKTVVNKKPPLQQGEKSDEEKEQEMKAFVKENEKLIKQYANYLVIWCINLAMDEKFDLMDHVAHQCICMQYLLELSKSLNIDPRACIGSFFSKIQIAEPDYKASFDDELKSFKERIRNRAKEKLDEALKEVEEEERQKRLGPGGLDPVEVFESLPDVLKKCFELQDTAMLQEAIASLSPEEATYHMKRCVDSGLWVPDAKKAAGESEDPQENTPDAEDPTYSAVD
cccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc
*VDYSKWKDIEISDDEDETHPNIDTPSLFRW************************KTLKT***************************************************WNV**********************************AFVKENEKLIKQYANYLVIWCINLAMDEKFDLMDHVAHQCICMQYLLELSKSLNIDPRACIGSFFSKIQIAEPDYKASFDDELKSFKERIRN*****************************VEVFESLPDVLKKCFELQDTAMLQEAIASLSPEEATYHMKRCVDSGLWV*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDYSKWKDIEISDDEDETHPNIDTPSLFRWRHQARVERxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTPWNVDTISKPGFTKTVVNKKPPLQQGEKSxxxxxxxxxxxxxxxxxxxxxYANYLVIWCINLAMDEKFDLMDHVAHQCICMQYLLELSKSLNIDPRACIGSFFSKIQIAEPDYKASFDDELxxxxxxxxxxxxxxxxxxxxxxxxxxxxKRLGPGGLDPVEVFESLPDVLKKCFELQDTAMLQEAIASLSPEEATYHMKRCVDSGLWVPDAKKAAGESEDPQENTPDAEDPTYSAVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hsp90 co-chaperone Cdc37 Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity.very confidentQ16543
Hsp90 co-chaperone Cdc37 Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity.very confidentQ61081
Hsp90 co-chaperone Cdc37 Co-chaperone that binds to numerous kinases and promotes their interaction with the Hsp90 complex, resulting in stabilization and promotion of their activity. Required for cytokinesis and chromosome segregation in mitosis and male meiosis.very confidentQ24276

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1US7, chain B
Confidence level:very confident
Coverage over the Query: 147-320
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 30-40
View the alignment between query and template
View the model in PyMOL