Diaphorina citri psyllid: psy15815


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MAAFWALINNMLEVRSDAFKLCCLYQRPIARRVKNIGAWQVLFLFVVFEHILLLLRYVLVYCISDKPHWVLFLFVVFEHILLLLRYVLVYCISDKPHWVRVALAKLNYQSRQALKNQ
cHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHc
MAAFWALINNMLEVRSDAFKLCCLYQRPIARRVKNIGAWQVLFLFVVFEHILLLLRYVLVYCISDKPHWVLFLFVVFEHILLLLRYVLVYCISDKPHWVRVALAKLNYQSRQALK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAFWALINNMLEVRSDAFKLCCLYQRPIARRVKNIGAWQVLFLFVVFEHILLLLRYVLVYCISDKPHWVLFLFVVFEHILLLLRYVLVYCISDKPHWVRVALAKLNYQSRQALKNQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005229 [MF]intracellular calcium activated chloride channel activityprobableGO:0022891, GO:0008509, GO:0022892, GO:0022838, GO:0005215, GO:0005216, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0015103, GO:0022803, GO:0022839, GO:0005253, GO:0005254, GO:0015108
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KWH, chain A
Confidence level:probable
Coverage over the Query: 93-113
View the alignment between query and template
View the model in PyMOL