Diaphorina citri psyllid: psy15827


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIELERFPDHSYYNMVSLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID
ccccccccccccccHHHHHHHHHHHHHcccccEEEccccccccEEEEcccccccccccccccccccccccccccccEEEEEcECcccccccEEEEEEEccc
MYYCWD*EPNERPNFTELCDLLEKLLLNETDYIELERFPDHSYYNMVSLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIELERFPDHSYYNMVSLSGEKLSNIMNDPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tyrosine kinase receptor Cad96Ca confidentQ9VBW3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FMK, chain A
Confidence level:very confident
Coverage over the Query: 46-99
View the alignment between query and template
View the model in PyMOL
Template: 2PVF, chain A
Confidence level:very confident
Coverage over the Query: 1-28
View the alignment between query and template
View the model in PyMOL