Psyllid ID: psy15827
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| 270002918 | 609 | cadherin 96Ca [Tribolium castaneum] | 0.534 | 0.088 | 0.796 | 1e-18 | |
| 91076662 | 625 | PREDICTED: similar to AGAP011648-PA [Tri | 0.534 | 0.086 | 0.796 | 1e-18 | |
| 156554757 | 626 | PREDICTED: tyrosine kinase receptor Cad9 | 0.534 | 0.086 | 0.759 | 2e-18 | |
| 157110899 | 706 | tyrosine kinase receptor [Aedes aegypti] | 0.504 | 0.072 | 0.685 | 4e-18 | |
| 158301106 | 706 | AGAP011648-PA [Anopheles gambiae str. PE | 0.534 | 0.076 | 0.666 | 1e-17 | |
| 195504470 | 776 | GE10728 [Drosophila yakuba] gi|194185194 | 0.534 | 0.069 | 0.703 | 3e-17 | |
| 194908866 | 777 | GG12279 [Drosophila erecta] gi|190656490 | 0.534 | 0.069 | 0.703 | 3e-17 | |
| 195107311 | 769 | GI23865 [Drosophila mojavensis] gi|19391 | 0.534 | 0.070 | 0.703 | 3e-17 | |
| 312385477 | 809 | hypothetical protein AND_00739 [Anophele | 0.534 | 0.066 | 0.648 | 4e-17 | |
| 194742439 | 769 | GF17093 [Drosophila ananassae] gi|190626 | 0.534 | 0.070 | 0.703 | 4e-17 |
| >gi|270002918|gb|EEZ99365.1| cadherin 96Ca [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 97.4 bits (241), Expect = 1e-18, Method: Compositional matrix adjust.
Identities = 43/54 (79%), Positives = 48/54 (88%)
Query: 1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIELERFPDHSYYNMVSLSGEKL 54
MYYCWDK+P +RP+F E LLEKLL+ ETDYIELERFPDHSYYNM+SLSGEKL
Sbjct: 556 MYYCWDKDPKQRPSFGECVQLLEKLLMTETDYIELERFPDHSYYNMMSLSGEKL 609
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91076662|ref|XP_971319.1| PREDICTED: similar to AGAP011648-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|156554757|ref|XP_001605632.1| PREDICTED: tyrosine kinase receptor Cad96Ca-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|157110899|ref|XP_001651299.1| tyrosine kinase receptor [Aedes aegypti] gi|108883900|gb|EAT48125.1| AAEL000850-PA, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|158301106|ref|XP_320863.4| AGAP011648-PA [Anopheles gambiae str. PEST] gi|157013481|gb|EAA00411.4| AGAP011648-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|195504470|ref|XP_002099093.1| GE10728 [Drosophila yakuba] gi|194185194|gb|EDW98805.1| GE10728 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194908866|ref|XP_001981852.1| GG12279 [Drosophila erecta] gi|190656490|gb|EDV53722.1| GG12279 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195107311|ref|XP_001998257.1| GI23865 [Drosophila mojavensis] gi|193914851|gb|EDW13718.1| GI23865 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|312385477|gb|EFR29966.1| hypothetical protein AND_00739 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|194742439|ref|XP_001953710.1| GF17093 [Drosophila ananassae] gi|190626747|gb|EDV42271.1| GF17093 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| FB|FBgn0022800 | 773 | Cad96Ca "Cadherin 96Ca" [Droso | 0.534 | 0.069 | 0.592 | 3.4e-12 | |
| UNIPROTKB|K7GQ46 | 235 | FGFR1 "Uncharacterized protein | 0.336 | 0.144 | 0.529 | 4.3e-05 | |
| UNIPROTKB|H7C265 | 371 | FGFR2 "Fibroblast growth facto | 0.336 | 0.091 | 0.588 | 4.9e-05 | |
| UNIPROTKB|F1LQ69 | 371 | Fgfr2 "Protein Fgfr2" [Rattus | 0.336 | 0.091 | 0.588 | 4.9e-05 | |
| UNIPROTKB|F1NCL8 | 770 | FGFR3 "Fibroblast growth facto | 0.504 | 0.066 | 0.444 | 8.1e-05 | |
| UNIPROTKB|F1PK02 | 648 | FGFR3 "Uncharacterized protein | 0.475 | 0.074 | 0.450 | 8.3e-05 | |
| UNIPROTKB|P18460 | 806 | FGFR3 "Fibroblast growth facto | 0.504 | 0.063 | 0.444 | 8.6e-05 | |
| UNIPROTKB|F1P3S0 | 811 | FGFR3 "Fibroblast growth facto | 0.504 | 0.062 | 0.444 | 8.6e-05 | |
| MGI|MGI:98397 | 541 | Src "Rous sarcoma oncogene" [M | 0.247 | 0.046 | 0.52 | 8.7e-05 | |
| UNIPROTKB|F1SEK8 | 548 | SRC "Uncharacterized protein" | 0.247 | 0.045 | 0.52 | 9e-05 |
| FB|FBgn0022800 Cad96Ca "Cadherin 96Ca" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 175 (66.7 bits), Expect = 3.4e-12, P = 3.4e-12
Identities = 32/54 (59%), Positives = 35/54 (64%)
Query: 1 MYYCWDKEPNERPNFTXXXXXXXXXXXXXTDYIELERFPDHSYYNMVSLSGEKL 54
MYYCW +P ERP F DYIELERFPDH+YYN+VSLSGEKL
Sbjct: 720 MYYCWSHDPQERPLFAEIIQMLDKLLHTEMDYIELERFPDHNYYNIVSLSGEKL 773
|
|
| UNIPROTKB|K7GQ46 FGFR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C265 FGFR2 "Fibroblast growth factor receptor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LQ69 Fgfr2 "Protein Fgfr2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NCL8 FGFR3 "Fibroblast growth factor receptor" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PK02 FGFR3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P18460 FGFR3 "Fibroblast growth factor receptor 3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3S0 FGFR3 "Fibroblast growth factor receptor" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98397 Src "Rous sarcoma oncogene" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SEK8 SRC "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| cd05053 | 293 | cd05053, PTKc_FGFR, Catalytic domain of the Protei | 5e-09 | |
| cd05099 | 314 | cd05099, PTKc_FGFR4, Catalytic domain of the Prote | 6e-07 | |
| cd05101 | 304 | cd05101, PTKc_FGFR2, Catalytic domain of the Prote | 2e-06 | |
| cd05100 | 334 | cd05100, PTKc_FGFR3, Catalytic domain of the Prote | 5e-06 | |
| cd05098 | 307 | cd05098, PTKc_FGFR1, Catalytic domain of the Prote | 5e-06 | |
| cd05054 | 337 | cd05054, PTKc_VEGFR, Catalytic domain of the Prote | 7e-05 | |
| cd05103 | 343 | cd05103, PTKc_VEGFR2, Catalytic domain of the Prot | 9e-05 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 1e-04 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 1e-04 | |
| cd05106 | 374 | cd05106, PTKc_CSF-1R, Catalytic domain of the Prot | 2e-04 | |
| cd05054 | 337 | cd05054, PTKc_VEGFR, Catalytic domain of the Prote | 3e-04 | |
| cd05035 | 273 | cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li | 4e-04 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 4e-04 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 4e-04 | |
| cd05071 | 262 | cd05071, PTKc_Src, Catalytic domain of the Protein | 5e-04 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 5e-04 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 5e-04 | |
| cd05045 | 290 | cd05045, PTKc_RET, Catalytic domain of the Protein | 6e-04 | |
| cd05055 | 302 | cd05055, PTKc_PDGFR, Catalytic domain of the Prote | 6e-04 | |
| cd05069 | 260 | cd05069, PTKc_Yes, Catalytic domain of the Protein | 7e-04 | |
| cd05066 | 267 | cd05066, PTKc_EphR_A, Catalytic domain of the Prot | 0.001 | |
| cd05102 | 338 | cd05102, PTKc_VEGFR3, Catalytic domain of the Prot | 0.001 | |
| cd05064 | 266 | cd05064, PTKc_EphR_A10, Catalytic domain of the Pr | 0.001 | |
| cd05070 | 260 | cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro | 0.001 | |
| cd05106 | 374 | cd05106, PTKc_CSF-1R, Catalytic domain of the Prot | 0.002 | |
| cd05067 | 260 | cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro | 0.002 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 0.003 | |
| cd05055 | 302 | cd05055, PTKc_PDGFR, Catalytic domain of the Prote | 0.004 | |
| cd05105 | 400 | cd05105, PTKc_PDGFR_alpha, Catalytic domain of the | 0.004 |
| >gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
Score = 51.3 bits (123), Expect = 5e-09
Identities = 18/35 (51%), Positives = 24/35 (68%)
Query: 67 SDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
D +WE+PR + + LGEG FGQV K EA+G+D
Sbjct: 3 LDPEWELPRDRLTLGKPLGEGAFGQVVKAEAVGLD 37
|
Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, and intracellular signaling. There are at least 23 FGFs and four types of FGFRs. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to more that one type of receptor. FGF/FGFR signaling is important in the regulation of embryonic development, homeostasis, and regenerative processes. Depending on the cell type and stage, FGFR signaling produces diverse cellular responses including proliferation, growth arrest, differentiation, and apoptosis. Aberrant signaling leads to many human diseases such as skeletal, olfactory, and metabolic disorders, as well as cancer. Length = 293 |
| >gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| KOG0197|consensus | 468 | 98.76 | ||
| KOG0193|consensus | 678 | 98.29 | ||
| KOG4278|consensus | 1157 | 98.19 | ||
| KOG0194|consensus | 474 | 98.19 | ||
| KOG1026|consensus | 774 | 98.01 | ||
| KOG4278|consensus | 1157 | 97.97 | ||
| KOG0200|consensus | 609 | 97.92 | ||
| KOG0192|consensus | 362 | 97.66 | ||
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 97.6 | |
| KOG4257|consensus | 974 | 97.58 | ||
| KOG1095|consensus | 1025 | 97.5 | ||
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 97.47 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 97.46 | |
| KOG2052|consensus | 513 | 97.45 | ||
| KOG0196|consensus | 996 | 97.34 | ||
| KOG0199|consensus | 1039 | 97.3 | ||
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 97.27 | |
| KOG0200|consensus | 609 | 97.22 | ||
| KOG0192|consensus | 362 | 97.09 | ||
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 97.07 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 97.06 | |
| KOG4721|consensus | 904 | 97.03 | ||
| KOG4257|consensus | 974 | 96.98 | ||
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 96.98 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 96.93 | |
| KOG1095|consensus | 1025 | 96.92 | ||
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 96.79 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 96.78 | |
| KOG1026|consensus | 774 | 96.76 | ||
| KOG4258|consensus | 1025 | 96.76 | ||
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 96.72 | |
| KOG0199|consensus | 1039 | 96.71 | ||
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 96.57 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 96.56 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 96.51 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 96.5 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 96.43 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 96.35 | |
| KOG1094|consensus | 807 | 96.28 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.27 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 96.21 | |
| KOG4721|consensus | 904 | 96.15 | ||
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 96.08 | |
| KOG1025|consensus | 1177 | 95.93 | ||
| KOG0196|consensus | 996 | 95.92 | ||
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 95.89 | |
| KOG0194|consensus | 474 | 95.86 | ||
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 95.8 | |
| KOG0193|consensus | 678 | 95.57 | ||
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 95.29 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 95.28 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 95.19 | |
| KOG1023|consensus | 484 | 95.18 | ||
| KOG0694|consensus | 694 | 95.08 | ||
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 95.03 | |
| KOG1025|consensus | 1177 | 95.01 | ||
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 94.89 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 94.89 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 94.88 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 94.5 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 94.48 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 94.46 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 94.25 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 94.11 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 94.03 | |
| KOG1163|consensus | 341 | 94.03 | ||
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 94.01 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 93.92 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 93.92 | |
| KOG0595|consensus | 429 | 93.89 | ||
| KOG0605|consensus | 550 | 93.88 | ||
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 93.73 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 93.59 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 93.57 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 93.57 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 93.5 | |
| KOG0580|consensus | 281 | 93.39 | ||
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 93.3 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 93.26 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 93.23 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 93.21 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 93.17 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 93.1 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 93.01 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 92.85 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 92.82 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 92.81 | |
| KOG0658|consensus | 364 | 92.8 | ||
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 92.78 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 92.78 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 92.73 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 92.73 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 92.57 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 92.55 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 92.42 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 92.37 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 92.35 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 92.28 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 92.21 | |
| KOG0598|consensus | 357 | 92.17 | ||
| PTZ00284 | 467 | protein kinase; Provisional | 92.17 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 92.05 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 92.05 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 92.02 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 91.97 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 91.91 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 91.86 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 91.55 | |
| KOG1165|consensus | 449 | 91.49 | ||
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 91.48 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 91.48 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 91.26 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 91.21 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 91.15 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 91.03 | |
| KOG1164|consensus | 322 | 90.96 | ||
| KOG0201|consensus | 467 | 90.84 | ||
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 90.81 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 90.76 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 90.64 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 90.52 | |
| KOG3653|consensus | 534 | 90.51 | ||
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 90.34 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 90.27 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 90.2 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 89.87 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 89.83 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 89.68 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 89.67 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 89.54 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 89.48 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 89.39 | |
| KOG0667|consensus | 586 | 89.27 | ||
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 89.17 | |
| KOG1187|consensus | 361 | 88.85 | ||
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 88.73 | |
| KOG0591|consensus | 375 | 88.43 | ||
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 88.31 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 88.28 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 88.19 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 87.78 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 87.64 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 87.61 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 87.61 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 87.4 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 86.97 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 86.87 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 86.59 | |
| KOG4236|consensus | 888 | 86.47 | ||
| KOG1024|consensus | 563 | 86.41 | ||
| KOG0696|consensus | 683 | 86.39 | ||
| KOG0600|consensus | 560 | 86.14 | ||
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 86.04 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 85.96 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 85.95 | |
| KOG0032|consensus | 382 | 85.85 | ||
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 85.83 | |
| KOG0594|consensus | 323 | 85.73 | ||
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 85.51 | |
| KOG0198|consensus | 313 | 85.41 | ||
| PHA02988 | 283 | hypothetical protein; Provisional | 85.39 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 85.07 | |
| KOG0660|consensus | 359 | 85.06 | ||
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 84.69 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 84.6 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 84.35 | |
| KOG0616|consensus | 355 | 84.33 | ||
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 84.03 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 83.97 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 83.93 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 83.87 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 83.82 | |
| KOG0612|consensus | 1317 | 83.76 | ||
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 83.53 | |
| KOG4250|consensus | 732 | 83.17 | ||
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 82.78 | |
| KOG1006|consensus | 361 | 82.64 | ||
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 82.61 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 82.38 | |
| KOG1152|consensus | 772 | 82.21 | ||
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 82.0 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 81.9 | |
| KOG1166|consensus | 974 | 81.69 | ||
| KOG0583|consensus | 370 | 81.29 | ||
| smart00090 | 237 | RIO RIO-like kinase. | 81.29 | |
| COG2112 | 201 | Predicted Ser/Thr protein kinase [Signal transduct | 81.17 | |
| KOG0198|consensus | 313 | 80.98 | ||
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 80.92 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 80.89 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 80.71 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 80.62 | |
| KOG1989|consensus | 738 | 80.59 | ||
| KOG0986|consensus | 591 | 80.56 | ||
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 80.4 | |
| KOG0596|consensus | 677 | 80.3 | ||
| KOG0576|consensus | 829 | 80.15 | ||
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 80.1 |
| >KOG0197|consensus | Back alignment and domain information |
|---|
Probab=98.76 E-value=1.6e-09 Score=80.27 Aligned_cols=60 Identities=28% Similarity=0.525 Sum_probs=48.6
Q ss_pred ccccccccccccccccccC-----CCccCCCCCCCceeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827 41 HSYYNMVSLSGEKLSNIMN-----DPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALGI 100 (101)
Q Consensus 41 ~~Y~~~~~~~~~~l~~~~~-----~p~~~~~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~ 100 (101)
.+|....++.+.++..++. .|.......+.|+|+++++++.+.||+|+||+||+|.|+|.
T Consensus 166 ~~~~~~~~gl~~~l~~p~~~~~~~~p~~~~~~~d~wei~r~~l~l~~~LG~G~FG~V~~g~~~~~ 230 (468)
T KOG0197|consen 166 NYYSKNADGLCTRLRDPCSKQGHTKPQTPDLARDPWEIPREELKLIRELGSGQFGEVWLGKWNGS 230 (468)
T ss_pred hhhhccCcchhhcccCchhccCCCCCCCCccccCCeeecHHHHHHHHHhcCCccceEEEEEEcCC
Confidence 3555566778888877763 35544455899999999999999999999999999999986
|
|
| >KOG0193|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG0200|consensus | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >KOG1095|consensus | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >KOG2052|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >KOG0200|consensus | Back alignment and domain information |
|---|
| >KOG0192|consensus | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >KOG1095|consensus | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >KOG1026|consensus | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >KOG1094|consensus | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4721|consensus | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >KOG0193|consensus | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG1023|consensus | Back alignment and domain information |
|---|
| >KOG0694|consensus | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >KOG1025|consensus | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >KOG1163|consensus | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >KOG0595|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >KOG0580|consensus | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >KOG0658|consensus | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >KOG1165|consensus | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >KOG1164|consensus | Back alignment and domain information |
|---|
| >KOG0201|consensus | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >KOG3653|consensus | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0667|consensus | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >KOG1187|consensus | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0591|consensus | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >KOG4236|consensus | Back alignment and domain information |
|---|
| >KOG1024|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >KOG0600|consensus | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >KOG0032|consensus | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0594|consensus | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >KOG0198|consensus | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0660|consensus | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >KOG4250|consensus | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1006|consensus | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >KOG1152|consensus | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG1166|consensus | Back alignment and domain information |
|---|
| >KOG0583|consensus | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0198|consensus | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG1989|consensus | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >KOG0596|consensus | Back alignment and domain information |
|---|
| >KOG0576|consensus | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 101 | ||||
| 2psq_A | 370 | Crystal Structure Of Unphosphorylated Unactivated W | 4e-06 | ||
| 1gjo_A | 316 | The Fgfr2 Tyrosine Kinase Domain Length = 316 | 6e-06 | ||
| 3b2t_A | 311 | Structure Of Phosphotransferase Length = 311 | 7e-06 | ||
| 3ri1_A | 313 | Crystal Structure Of The Catalytic Domain Of Fgfr2 | 7e-06 | ||
| 2pz5_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 5e-05 | ||
| 2q0b_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 5e-05 | ||
| 2pzr_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 5e-05 | ||
| 3cly_A | 334 | Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase | 5e-05 | ||
| 2pwl_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 5e-05 | ||
| 2py3_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 5e-05 | ||
| 2pvy_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 5e-05 | ||
| 2pzp_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 5e-05 | ||
| 2pvf_A | 334 | Crystal Structure Of Tyrosine Phosphorylated Activa | 5e-05 | ||
| 3tt0_A | 382 | Co-Structure Of Fibroblast Growth Factor Receptor 1 | 1e-04 | ||
| 3gqi_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 1e-04 | ||
| 3js2_A | 317 | Crystal Structure Of Minimal Kinase Domain Of Fibro | 1e-04 | ||
| 3rhx_B | 306 | Crystal Structure Of The Catalytic Domain Of Fgfr1 | 1e-04 | ||
| 3kxx_A | 317 | Structure Of The Mutant Fibroblast Growth Factor Re | 1e-04 | ||
| 1fgk_A | 310 | Crystal Structure Of The Tyrosine Kinase Domain Of | 1e-04 | ||
| 4f63_A | 309 | Crystal Structure Of Human Fibroblast Growth Factor | 1e-04 | ||
| 3gql_A | 326 | Crystal Structure Of Activated Receptor Tyrosine Ki | 2e-04 | ||
| 3c4f_A | 302 | Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M | 2e-04 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 3e-04 | ||
| 2p2i_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 4e-04 | ||
| 2p2h_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 4e-04 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 4e-04 | ||
| 4agc_A | 353 | Crystal Structure Of Vegfr2 (Juxtamembrane And Kina | 4e-04 | ||
| 3ewh_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 4e-04 | ||
| 3u6j_A | 314 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 4e-04 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 4e-04 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 4e-04 | ||
| 3vid_A | 356 | Crystal Structure Of Human Vegfr2 Kinase Domain Wit | 4e-04 | ||
| 3vhe_A | 359 | Crystal Structure Of Human Vegfr2 Kinase Domain Wit | 4e-04 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 4e-04 | ||
| 1ywn_A | 316 | Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p | 4e-04 | ||
| 3c7q_A | 316 | Structure Of Vegfr2 Kinase Domain In Complex With B | 4e-04 | ||
| 1vr2_A | 316 | Human Vascular Endothelial Growth Factor Receptor 2 | 5e-04 | ||
| 3vhk_A | 368 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 5e-04 | ||
| 3vnt_A | 318 | Crystal Structure Of The Kinase Domain Of Human Veg | 5e-04 | ||
| 2xir_A | 316 | Crystal Structure Of The Vegfr2 Kinase Domain In Co | 5e-04 | ||
| 1y6a_A | 366 | Crystal Structure Of Vegfr2 In Complex With A 2-Ani | 5e-04 | ||
| 1yol_A | 283 | Crystal Structure Of Src Kinase Domain In Complex W | 5e-04 | ||
| 2bdf_A | 279 | Src Kinase In Complex With Inhibitor Ap23451 Length | 5e-04 | ||
| 1yoj_A | 283 | Crystal Structure Of Src Kinase Domain Length = 283 | 6e-04 | ||
| 3geq_A | 286 | Structural Basis For The Chemical Rescue Of Src Kin | 6e-04 | ||
| 2oiq_A | 286 | Crystal Structure Of Chicken C-Src Kinase Domain In | 6e-04 | ||
| 2hwo_A | 286 | Crystal Structure Of Src Kinase Domain In Complex W | 6e-04 | ||
| 3svv_A | 286 | Crystal Structure Of T338c C-Src Covalently Bound T | 6e-04 | ||
| 3oez_A | 286 | Crystal Structure Of The L317i Mutant Of The Chicke | 6e-04 | ||
| 3dqw_A | 286 | C-Src Kinase Domain Thr338ile Mutant In Complex Wit | 6e-04 | ||
| 3g6h_A | 286 | Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma | 6e-04 | ||
| 2qq7_A | 286 | Crystal Structure Of Drug Resistant Src Kinase Doma | 6e-04 | ||
| 1yi6_A | 276 | C-Term Tail Segment Of Human Tyrosine Kinase (258-5 | 9e-04 | ||
| 3d7u_B | 277 | Structural Basis For The Recognition Of C-Src By It | 9e-04 |
| >pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 | Back alignment and structure |
|
| >pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 | Back alignment and structure |
| >pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 | Back alignment and structure |
| >pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 | Back alignment and structure |
| >pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 | Back alignment and structure |
| >pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 | Back alignment and structure |
| >pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 | Back alignment and structure |
| >pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 | Back alignment and structure |
| >pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 | Back alignment and structure |
| >pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 | Back alignment and structure |
| >pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 | Back alignment and structure |
| >pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 | Back alignment and structure |
| >pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 | Back alignment and structure |
| >pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 | Back alignment and structure |
| >pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 | Back alignment and structure |
| >pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 | Back alignment and structure |
| >pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 | Back alignment and structure |
| >pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 | Back alignment and structure |
| >pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 | Back alignment and structure |
| >pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 | Back alignment and structure |
| >pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 | Back alignment and structure |
| >pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 | Back alignment and structure |
| >pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 | Back alignment and structure |
| >pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 | Back alignment and structure |
| >pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 | Back alignment and structure |
| >pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 | Back alignment and structure |
| >pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 | Back alignment and structure |
| >pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 | Back alignment and structure |
| >pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 | Back alignment and structure |
| >pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 | Back alignment and structure |
| >pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 | Back alignment and structure |
| >pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 | Back alignment and structure |
| >pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 | Back alignment and structure |
| >pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 | Back alignment and structure |
| >pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 | Back alignment and structure |
| >pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 | Back alignment and structure |
| >pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 2e-14 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 8e-09 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 3e-12 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 9e-08 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 5e-12 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 2e-09 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 7e-12 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 4e-09 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 7e-12 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 2e-09 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 7e-12 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 1e-07 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 1e-11 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 1e-08 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 2e-11 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 2e-07 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 2e-11 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 7e-08 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 2e-11 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 6e-10 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 2e-11 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 9e-09 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 1e-10 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 3e-07 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 2e-10 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 3e-06 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 3e-10 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 2e-06 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 6e-10 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 4e-09 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 7e-10 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 2e-06 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 1e-09 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 3e-07 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 1e-09 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 4e-07 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 1e-09 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 4e-07 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 1e-09 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 5e-04 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 2e-09 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 5e-06 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 3e-09 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 3e-09 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 4e-09 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 1e-06 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 5e-09 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 3e-06 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 5e-09 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 1e-08 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 5e-09 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 2e-07 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 7e-09 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 4e-08 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 8e-09 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 2e-05 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 8e-09 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 4e-06 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 9e-09 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 3e-07 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 9e-09 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 2e-07 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 1e-08 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 2e-08 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 2e-08 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 2e-06 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 2e-08 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 6e-07 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 2e-08 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 4e-08 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 2e-08 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 1e-06 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 3e-08 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 3e-08 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 4e-08 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 1e-07 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 3e-06 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 2e-07 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 4e-06 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 2e-07 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 1e-05 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 4e-07 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 2e-06 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 5e-07 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 1e-05 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 5e-07 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 2e-06 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 5e-07 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 1e-06 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 8e-07 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 4e-06 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 9e-07 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 1e-06 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 1e-06 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 3e-04 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 1e-06 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 6e-05 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 1e-06 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 3e-05 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 1e-06 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 2e-06 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 3e-06 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 4e-06 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 1e-05 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 5e-06 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 2e-04 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 1e-05 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 3e-05 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 1e-05 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 2e-05 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 1e-05 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 6e-05 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 2e-05 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 2e-05 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 9e-04 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 3e-05 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 3e-05 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 4e-05 |
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
Score = 65.8 bits (161), Expect = 2e-14
Identities = 13/52 (25%), Positives = 25/52 (48%)
Query: 1 MYYCWDKEPNERPNFTELCDLLEKLLLNETDYIELERFPDHSYYNMVSLSGE 52
M CW ++P ERP+F ++ L ++L Y+ + +Y + + E
Sbjct: 274 MRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEE 325
|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 98.46 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 98.4 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 98.15 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 98.07 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 98.06 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 97.99 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 97.98 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 97.95 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 97.88 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 97.85 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 97.6 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.59 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 97.51 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.42 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 97.37 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 97.33 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 97.23 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 97.22 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 97.18 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 97.15 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 97.13 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 97.12 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 97.11 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 97.11 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 97.11 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 97.1 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 97.09 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 97.04 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 97.02 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 97.0 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 96.96 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 96.93 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 96.91 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 96.9 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 96.87 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 96.87 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 96.87 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 96.85 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 96.85 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 96.84 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 96.84 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 96.84 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 96.84 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 96.8 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 96.78 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 96.78 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 96.76 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 96.73 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 96.73 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 96.73 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 96.72 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 96.72 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 96.7 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 96.7 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 96.7 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 96.66 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 96.66 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 96.66 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 96.65 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 96.65 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 96.64 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 96.64 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 96.63 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 96.62 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 96.6 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 96.6 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 96.59 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 96.58 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 96.58 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 96.58 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 96.57 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 96.55 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 96.55 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 96.54 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 96.5 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 96.47 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 96.43 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 96.42 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 96.34 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 96.32 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 96.3 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 96.29 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 96.27 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 96.27 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 96.26 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 96.23 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 96.2 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 96.19 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 96.18 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 96.18 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 96.16 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 96.13 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 96.13 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 96.11 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 96.07 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 96.05 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 95.99 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 95.98 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 95.96 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 95.96 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 95.95 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 95.94 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 95.89 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 95.88 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 95.85 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 95.83 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 95.82 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 95.79 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 95.76 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 95.73 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 95.71 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 95.7 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 95.66 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 95.62 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 95.52 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 95.52 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 95.5 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 95.42 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 95.4 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 95.34 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 95.31 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 95.12 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 95.1 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 95.03 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 95.01 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 94.96 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 94.96 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 94.94 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 94.92 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 94.92 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 94.91 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 94.88 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 94.84 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 94.8 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 94.71 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 94.65 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 94.6 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 94.59 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 94.56 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 94.5 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 94.42 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 94.28 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 94.27 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 94.26 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 94.26 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 94.22 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 94.22 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 94.17 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 94.17 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 94.16 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 94.16 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 94.16 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 94.13 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 94.09 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 94.07 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 94.06 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 94.05 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 94.01 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 94.01 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 93.99 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 93.98 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 93.98 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 93.97 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 93.94 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 93.94 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 93.92 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 93.88 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 93.85 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 93.81 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 93.81 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 93.79 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 93.78 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 93.7 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 93.7 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 93.69 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 93.64 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 93.59 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 93.51 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 93.46 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 93.45 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 93.44 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 93.42 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 93.42 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 93.41 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 93.31 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 93.3 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 93.3 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 93.29 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 93.28 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 93.24 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 93.22 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 93.21 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 93.18 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 93.17 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 93.16 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 93.14 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 93.08 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 93.08 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 93.08 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 93.08 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 93.07 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 93.06 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 93.05 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 93.02 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 93.02 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 92.98 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 92.98 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 92.96 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 92.92 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 92.92 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 92.92 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 92.92 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 92.91 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 92.9 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 92.85 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 92.83 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 92.83 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 92.81 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 92.8 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 92.78 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 92.75 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 92.69 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 92.66 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 92.66 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 92.65 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 92.62 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 92.61 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 92.59 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 92.57 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 92.56 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 92.56 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 92.51 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 92.49 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 92.47 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 92.47 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 92.47 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 92.46 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 92.45 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 92.4 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 92.4 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 92.4 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 92.38 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 92.34 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 92.3 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 92.29 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 92.29 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 92.28 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 92.27 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 92.24 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 92.24 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 92.22 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 92.22 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 92.2 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 92.16 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 92.15 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 92.14 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 92.14 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 92.13 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 92.1 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 92.09 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 92.07 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 92.06 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 92.06 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 92.02 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 91.98 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 91.98 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 91.94 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 91.94 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 91.87 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 91.86 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 91.81 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 91.75 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 91.74 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 91.73 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 91.72 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 91.72 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 91.71 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 91.7 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 91.65 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 91.6 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 91.6 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 91.58 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 91.56 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 91.55 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 91.54 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 91.54 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 91.53 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 91.52 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 91.52 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 91.49 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 91.49 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 91.49 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 91.48 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 91.46 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 91.42 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 91.4 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 91.4 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 91.39 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 91.27 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 91.27 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 91.22 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 91.2 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 91.19 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 91.18 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 91.14 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 91.14 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 91.02 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 90.96 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 90.94 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 90.92 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 90.91 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 90.89 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 90.88 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 90.81 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 90.77 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 90.76 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 90.72 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 90.72 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 90.69 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 90.68 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 90.63 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 90.6 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 90.6 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 90.56 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 90.55 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 90.48 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 90.4 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 90.39 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 90.27 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 90.22 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 90.19 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 90.09 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 90.09 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 90.06 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 89.93 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 89.9 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 89.87 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 89.83 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 89.83 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 89.82 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 89.75 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 89.7 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 89.7 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 89.67 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 89.64 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 89.59 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 89.56 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 89.54 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 89.53 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 89.32 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 89.31 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 89.28 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 89.23 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 89.13 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 88.91 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 88.9 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 88.87 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 88.86 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 88.62 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 88.6 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 88.58 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 88.46 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 88.44 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 88.17 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 88.09 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 88.04 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 87.8 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 87.68 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 87.47 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 87.37 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 87.35 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 87.31 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 87.29 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 87.15 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 87.13 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 86.71 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 86.7 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 86.64 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 86.49 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 86.44 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 86.12 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 86.01 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 85.68 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 85.47 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 85.3 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 84.85 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 84.14 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 82.72 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 81.0 |
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
Probab=98.46 E-value=6e-08 Score=68.90 Aligned_cols=33 Identities=48% Similarity=0.919 Sum_probs=30.3
Q ss_pred CCCceeeCCCeeEeceeccccCceEEEeEEecC
Q psy15827 68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGI 100 (101)
Q Consensus 68 ~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g~ 100 (101)
.++|||+++++++.+.||+|+||.||+|++.+.
T Consensus 56 ~~~wEi~~~~~~l~~~LG~G~fG~Vy~a~~~~~ 88 (353)
T 4ase_A 56 ASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGI 88 (353)
T ss_dssp HHHHBCCGGGEEEEEEEEECSSEEEEEEEEETS
T ss_pred CcccEecHHHeEEeeEEecCCCeEEEEEEEcCC
Confidence 357999999999999999999999999998764
|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 101 | ||||
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 5e-07 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 0.001 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 5e-07 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 0.001 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 1e-06 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 6e-04 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 1e-06 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 2e-06 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 2e-06 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 4e-06 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 0.002 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 6e-06 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 2e-05 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 2e-05 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 0.001 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 3e-05 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 6e-04 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 7e-05 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 0.001 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 1e-04 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 2e-04 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 0.001 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 5e-04 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 5e-04 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 6e-04 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 6e-04 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 8e-04 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 0.002 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 0.002 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 0.004 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 0.004 |
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Fibroblast growth factor receptor 1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 44.1 bits (103), Expect = 5e-07
Identities = 17/34 (50%), Positives = 23/34 (67%)
Query: 68 DDKWEVPRQHIKVFDILGEGCFGQVWKCEALGID 101
D +WE+PR + + LGEG FGQV EA+G+D
Sbjct: 5 DPRWELPRDRLVLGKPLGEGAFGQVVLAEAIGLD 38
|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 98.65 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 98.52 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 98.5 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 98.45 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 98.41 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 98.37 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 98.35 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 98.32 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 98.22 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 98.01 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 97.98 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 97.81 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 97.67 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 97.59 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 97.58 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 97.5 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 97.49 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 97.41 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 97.39 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 97.29 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 97.12 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 96.96 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 96.95 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 96.63 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 96.53 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 96.32 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 96.19 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 96.16 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 96.15 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 96.09 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 95.62 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 95.6 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 95.57 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 95.51 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 95.43 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 95.27 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 95.24 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 95.19 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 95.19 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 95.13 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 95.04 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 94.97 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 94.85 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 94.63 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 94.29 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 93.88 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 93.59 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 93.26 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 93.06 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 92.23 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 92.15 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 92.11 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 92.07 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 91.46 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 91.19 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 90.82 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 90.67 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 90.24 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 89.54 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 88.94 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 88.01 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 87.99 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 87.7 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 87.69 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 85.41 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 84.31 |
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: c-src tyrosine kinase species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.65 E-value=8.5e-09 Score=69.52 Aligned_cols=40 Identities=38% Similarity=0.847 Sum_probs=35.6
Q ss_pred CCccCCCCCCCceeeCCCeeEeceeccccCceEEEeEEec
Q psy15827 60 DPVLNQKSDDKWEVPRQHIKVFDILGEGCFGQVWKCEALG 99 (101)
Q Consensus 60 ~p~~~~~~~~~w~i~~~~~~~~~~lG~G~fg~v~~g~~~g 99 (101)
+|.+.+..+++|||+++++++.+.||+|+||.||+|++.+
T Consensus 1 ~~~~~~~~~~~~~i~~~~~~i~~~iG~G~fg~Vy~~~~~~ 40 (285)
T d1fmka3 1 KPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNG 40 (285)
T ss_dssp CCCCSSSSTTCSBCCGGGEEEEEEEEECSSCEEEEEEETT
T ss_pred CCCCCCCCCcceEcCHHHEEEeeEEeeCCCeEEEEEEECC
Confidence 3566677889999999999999999999999999999864
|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|