Diaphorina citri psyllid: psy1582

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13

MHDNRPQAVAPTQIRDRLSATYHTSRVLIISALTQEEVVSHSMDISTISPQEGWAEQDPMEILQAVQTTMDRAIEKLSAHGLSRDDIVTLGITNQRETTVVWDLNTGEPLYNAIEQGLRIVDCGSGRFN

ccccccccccccccEEEEccccccccEEEEEcccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccEEEEccccccccccEEEEccccccccccccc

**************RDRLSATYHTSRVLIISALTQEEVVSHSMDISTISPQEGWAEQDPMEILQAVQTTMDRAIEKLSAHGLSRDDIVTLGITNQRETTVVWDLNTGEPLYNAIEQGLRIVDCG*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHDNRPQAVAPTQIRDRLSATYHTSRVLIISALTQEEVVSHSMDISTISPQEGWAEQDPMEILQAVQTTMDRAIEKLSAHGLSRDDIVTLGITNQRETTVVWDLNTGEPLYNAIEQGLRIVDCGSGRFN

Annotation	Function Description	Confidence Level	Reference Protein
Glycerol kinase	Key enzyme in the regulation of glycerol uptake and metabolism.	confident	A3QIN4
Glycerol kinase	Key enzyme in the regulation of glycerol uptake and metabolism.	confident	C3KBM0
Glycerol kinase	Key enzyme in the regulation of glycerol uptake and metabolism.	confident	Q1IE16

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008150 [BP]	biological_process	probable
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

No confident prediction of EC number!

Template: 4E1J, chain A
Confidence level:very confident
Coverage over the Query: 4-128
View the alignment between query and template
View the model in PyMOL