Diaphorina citri psyllid: psy15857

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-----

MKGPVAKSTVEKDADYYRMDHKHRGLALIFNHEHFDSPHLKSRAGTGADFENLYTTLVNLGFVVKPYHDPEFKVIQNAIDEAAEQDYTDADCFVMAVLTHGEDGILHAKDVPYKPKNLWSKFTADNCLTLAGKPKLFFIQACQGDKLDAGVTIRTQVDGHPSNTYSIPLHADFLMAYSTISDSPMFGQRFGLKDKCSKVVSKTYQVMSSNVDTSNGECQTDGHESHTNGSAVGKDEGDVLGFKFQTDGHESHTNGSAVGKDEGDVLGFNFGRTRMKGPVAKSTVEKDADYYRMDHKHRGLALIFNHEHFDSPHLKSRAGTGADFENLYTTLVNLGFVVKPYHDPEFKVIQNAIDEGPVAKSTVEKDADYYRMDHKHRGLALIFNHEHFDSPHLKSRAGTGADFENLYTTLVNLGFVVKPYHDPEFKVIQNAIDEGKDALIPSLFLPHSNKAGVFY

cccccccccccccccccccccccEEEEEEECccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHccccccccEEEEEEEcccccccEEECcccccHHHHcccccccccccccccccEEEEEccccccccccEEEECcccccccccccccccccEEEEEEcccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHcccEEEECccccHHHHHHHcccccccccccccccEEcccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEEEEEEccccccccccc

***************YYRMDHKHRGLALIFNHEHFDSPHLKSRAGTGADFENLYTTLVNLGFVVKPYHDPEFKVIQNAIDEAAEQDYTDADCFVMAVLTHGEDGILHAKDVPYKPKNLWSKFTADNCLTLAGKPKLFFIQACQGDKLDAGVTIRTQVDGHPSNTYSIPLHADFLMAYSTISDSPMFGQRFGLKDKCSKVVSKTYQVMSSNVDTSNG*************SAVGKDEGDVLGFKFQTDGHESHTNGSAVGK************************EKDADYYRMDHKHRGLALIFNHEHFDSPHLKSRAGTGADFENLYTTLVNLGFVVKPYHDPEFKVIQNAIDEGPVAKSTVEKDADYYRMDHKHRGLALIFNHEHFDSPHLKSRAGTGADFENLYTTLVNLGFVVKPYHDPEFKVIQNAIDEGKDALIPSLFLPHSNKAGVFY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Caspase	Involved in the activation cascade of caspases responsible for apoptosis execution. Acts downstream of rpr. Cleaves baculovirus p35 and lamin DmO in vitro.	confident	O01382

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006979 [BP]	response to oxidative stress	probable	GO:0006950, GO:0008150, GO:0050896
GO:0043068 [BP]	positive regulation of programmed cell death	probable	GO:0050794, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0010033 [BP]	response to organic substance	probable	GO:0042221, GO:0050896, GO:0008150
GO:0004175 [MF]	endopeptidase activity	probable	GO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006508 [BP]	proteolysis	probable	GO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0035103 [BP]	sterol regulatory element binding protein cleavage	probable	GO:0044238, GO:0019219, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0010628, GO:0023052, GO:0007165, GO:0045935, GO:0050789, GO:0044699, GO:0080090, GO:0044267, GO:0051716, GO:0010604, GO:0044260, GO:0051171, GO:0009891, GO:2000112, GO:0071704, GO:0010467, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0032933, GO:0006984, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0008150, GO:0045893, GO:0008152, GO:2001141, GO:0016485, GO:0007154, GO:0044700, GO:0071501, GO:0051604, GO:0006991, GO:0019538, GO:0050896, GO:0051252, GO:0051254, GO:0044237, GO:0043170, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0033554, GO:0044763, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M72, chain A
Confidence level:very confident
Coverage over the Query: 5-215
View the alignment between query and template
View the model in PyMOL

Template: 2NN3, chain C
Confidence level:very confident
Coverage over the Query: 284-354,368-413
View the alignment between query and template
View the model in PyMOL

Template: 3BIJ, chain A
Confidence level:probable
Coverage over the Query: 376-449
View the alignment between query and template
View the model in PyMOL