Diaphorina citri psyllid: psy15865

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------

MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQTAGSGSLEKPAPGQIAPDGPPKNALTTNNNGV

cccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccc

MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQ********************************

xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQTAGSGSLEKPAPGQIAPDGPPKNALTTNNNGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044459 [CC]	plasma membrane part	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0015770 [BP]	sucrose transport	probable	GO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015771 [BP]	trehalose transport	probable	GO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015574 [MF]	trehalose transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0051119, GO:1901476, GO:0005215, GO:0015157, GO:0022857, GO:0003674, GO:0015154, GO:0015151, GO:0015144, GO:0042947
GO:0015767 [BP]	lactose transport	probable	GO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0015768 [BP]	maltose transport	probable	GO:0015766, GO:0015772, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 2-91
View the alignment between query and template
View the model in PyMOL