Psyllid ID: psy15865
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 156 | ||||||
| 357619316 | 540 | putative sugar transporter [Danaus plexi | 0.455 | 0.131 | 0.583 | 7e-19 | |
| 307176944 | 517 | Sugar transporter ERD6-like 6 [Camponotu | 0.461 | 0.139 | 0.597 | 7e-19 | |
| 332016797 | 531 | Sugar transporter ERD6-like 2 [Acromyrme | 0.461 | 0.135 | 0.597 | 7e-19 | |
| 291461585 | 544 | sugar transporter 13 [Nilaparvata lugens | 0.461 | 0.132 | 0.652 | 8e-19 | |
| 242020658 | 545 | conserved hypothetical protein [Pediculu | 0.461 | 0.132 | 0.597 | 1e-18 | |
| 193688235 | 560 | PREDICTED: facilitated trehalose transpo | 0.461 | 0.128 | 0.569 | 2e-18 | |
| 91082977 | 1252 | PREDICTED: similar to sugar transporter | 0.461 | 0.057 | 0.611 | 2e-18 | |
| 270007037 | 1229 | hypothetical protein TcasGA2_TC013484 [T | 0.461 | 0.058 | 0.611 | 3e-18 | |
| 307207615 | 526 | Sugar transporter ERD6-like 7 [Harpegnat | 0.461 | 0.136 | 0.583 | 1e-17 | |
| 322800186 | 588 | hypothetical protein SINV_08656 [Solenop | 0.461 | 0.122 | 0.583 | 1e-17 |
| >gi|357619316|gb|EHJ71940.1| putative sugar transporter [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 98.6 bits (244), Expect = 7e-19, Method: Compositional matrix adjust.
Identities = 42/72 (58%), Positives = 56/72 (77%)
Query: 8 VLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALY 67
VLTYVAEITQPHLRG L+AT+SM I G +Q G ++WR+ A++N+ F ++A+ AL+
Sbjct: 141 VLTYVAEITQPHLRGALTATSSMCIIIGVFTQFLFGLLMYWRTVALVNIFFALIAILALF 200
Query: 68 FIPESPHWLISK 79
FIPESPHWL+ K
Sbjct: 201 FIPESPHWLVMK 212
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307176944|gb|EFN66250.1| Sugar transporter ERD6-like 6 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332016797|gb|EGI57618.1| Sugar transporter ERD6-like 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|291461585|dbj|BAI83427.1| sugar transporter 13 [Nilaparvata lugens] | Back alignment and taxonomy information |
|---|
| >gi|242020658|ref|XP_002430769.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515966|gb|EEB18031.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|193688235|ref|XP_001945235.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91082977|ref|XP_974017.1| PREDICTED: similar to sugar transporter [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270007037|gb|EFA03485.1| hypothetical protein TcasGA2_TC013484 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307207615|gb|EFN85275.1| Sugar transporter ERD6-like 7 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322800186|gb|EFZ21271.1| hypothetical protein SINV_08656 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 156 | ||||||
| FB|FBgn0051100 | 716 | CG31100 [Drosophila melanogast | 0.474 | 0.103 | 0.506 | 1.2e-13 | |
| TAIR|locus:2079802 | 462 | AT3G05400 [Arabidopsis thalian | 0.467 | 0.158 | 0.369 | 7.4e-10 | |
| TAIR|locus:2036039 | 464 | AT1G08890 [Arabidopsis thalian | 0.448 | 0.150 | 0.4 | 8.9e-09 | |
| TAIR|locus:504955729 | 327 | AT3G05155 [Arabidopsis thalian | 0.448 | 0.214 | 0.357 | 1.2e-08 | |
| TAIR|locus:2096234 | 458 | AT3G05160 [Arabidopsis thalian | 0.448 | 0.152 | 0.385 | 1.8e-08 | |
| TAIR|locus:2036009 | 462 | AT1G08900 [Arabidopsis thalian | 0.448 | 0.151 | 0.385 | 1.9e-08 | |
| TAIR|locus:2146365 | 478 | SFP2 [Arabidopsis thaliana (ta | 0.448 | 0.146 | 0.385 | 2e-08 | |
| TAIR|locus:2146350 | 474 | SFP1 [Arabidopsis thaliana (ta | 0.448 | 0.147 | 0.371 | 3.2e-08 | |
| TAIR|locus:505006329 | 467 | AT3G05165 [Arabidopsis thalian | 0.448 | 0.149 | 0.371 | 5.1e-08 | |
| TAIR|locus:2025132 | 487 | ERDL6 "ERD6-like 6" [Arabidops | 0.442 | 0.141 | 0.391 | 7e-08 |
| FB|FBgn0051100 CG31100 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 188 (71.2 bits), Expect = 1.2e-13, P = 1.2e-13
Identities = 39/77 (50%), Positives = 49/77 (63%)
Query: 1 MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPI 60
M AP VLTYVAEIT+P RG+LSA + I G Q LGS + WRS A ++ FP+
Sbjct: 166 MEAP---VLTYVAEITEPKYRGILSALGTTCVITGVFIQFILGSLMDWRSVAAVSSAFPV 222
Query: 61 LALCALYFIPESPHWLI 77
+ + L F+PESP WLI
Sbjct: 223 ITIIMLCFVPESPVWLI 239
|
|
| TAIR|locus:2079802 AT3G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036039 AT1G08890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955729 AT3G05155 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096234 AT3G05160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036009 AT1G08900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146365 SFP2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146350 SFP1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006329 AT3G05165 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025132 ERDL6 "ERD6-like 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 156 | |||
| TIGR00879 | 481 | TIGR00879, SP, MFS transporter, sugar porter (SP) | 1e-08 | |
| pfam00083 | 449 | pfam00083, Sugar_tr, Sugar (and other) transporter | 2e-06 | |
| PRK10077 | 479 | PRK10077, xylE, D-xylose transporter XylE; Provisi | 3e-05 |
| >gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
Score = 52.0 bits (125), Expect = 1e-08
Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 7/82 (8%)
Query: 6 VLVLTYVAEITQPHLRGMLSATASMTTIFG-------TVSQLFLGSFLHWRSAAILNLLF 58
LV Y++EI LRG L++ + FG ++ L + L WR L L+
Sbjct: 146 ALVPMYLSEIAPKALRGALTSLYQLAITFGILVAYGFGSGKVSLNNTLGWRIPLGLQLIP 205
Query: 59 PILALCALYFIPESPHWLISKY 80
L L+F+PESP WL+ K
Sbjct: 206 AGLLFLGLFFLPESPRWLVGKG 227
|
This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481 |
| >gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter | Back alignment and domain information |
|---|
| >gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| KOG0569|consensus | 485 | 99.76 | ||
| KOG0254|consensus | 513 | 99.6 | ||
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 99.57 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 99.56 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 99.51 | |
| KOG0253|consensus | 528 | 99.41 | ||
| KOG0255|consensus | 521 | 99.37 | ||
| TIGR00898 | 505 | 2A0119 cation transport protein. | 99.34 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 99.27 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 99.02 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 99.01 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 98.94 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 98.89 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 98.77 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 98.58 | |
| KOG0252|consensus | 538 | 98.49 | ||
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 98.48 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 98.46 | |
| PRK15075 | 434 | citrate-proton symporter; Provisional | 98.31 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 98.25 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 98.23 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 98.17 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 98.16 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 98.06 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 98.05 | |
| COG2814 | 394 | AraJ Arabinose efflux permease [Carbohydrate trans | 97.92 | |
| KOG2533|consensus | 495 | 97.87 | ||
| PRK15403 | 413 | multidrug efflux system protein MdtM; Provisional | 97.87 | |
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 97.87 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 97.86 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 97.86 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 97.86 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 97.81 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 97.79 | |
| TIGR00880 | 141 | 2_A_01_02 Multidrug resistance protein. | 97.77 | |
| TIGR00901 | 356 | 2A0125 AmpG-related permease. | 97.74 | |
| PRK11195 | 393 | lysophospholipid transporter LplT; Provisional | 97.73 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 97.73 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 97.71 | |
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 97.68 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 97.67 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 97.67 | |
| PTZ00207 | 591 | hypothetical protein; Provisional | 97.66 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 97.63 | |
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 97.56 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 97.55 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 97.55 | |
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 97.55 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 97.51 | |
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 97.38 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 97.35 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 97.33 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 97.3 | |
| KOG2532|consensus | 466 | 97.28 | ||
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 97.27 | |
| KOG2615|consensus | 451 | 97.26 | ||
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 97.26 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 97.26 | |
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 97.24 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 97.24 | |
| KOG1330|consensus | 493 | 97.22 | ||
| TIGR00889 | 418 | 2A0110 nucleoside transporter. This family of prot | 97.21 | |
| PRK12382 | 392 | putative transporter; Provisional | 97.19 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 97.14 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 97.11 | |
| PRK10504 | 471 | putative transporter; Provisional | 97.1 | |
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 97.08 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 97.04 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 97.03 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 97.01 | |
| TIGR00898 | 505 | 2A0119 cation transport protein. | 96.99 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 96.97 | |
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 96.96 | |
| PF06609 | 599 | TRI12: Fungal trichothecene efflux pump (TRI12); I | 96.93 | |
| PRK03699 | 394 | putative transporter; Provisional | 96.89 | |
| PRK11043 | 401 | putative transporter; Provisional | 96.86 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 96.84 | |
| TIGR00806 | 511 | rfc RFC reduced folate carrier. Proteins of the RF | 96.74 | |
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 96.71 | |
| PRK10054 | 395 | putative transporter; Provisional | 96.7 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 96.67 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 96.67 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 96.67 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 96.6 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 96.59 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 96.55 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 96.53 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 96.51 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 96.38 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 96.35 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 96.33 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 96.29 | |
| PRK12382 | 392 | putative transporter; Provisional | 96.24 | |
| TIGR01272 | 310 | gluP glucose/galactose transporter. Disruption of | 96.11 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 96.02 | |
| PRK10133 | 438 | L-fucose transporter; Provisional | 95.94 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 95.93 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 95.92 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 95.91 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 95.87 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 95.75 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 95.75 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 95.61 | |
| TIGR01301 | 477 | GPH_sucrose GPH family sucrose/H+ symporter. This | 95.39 | |
| PRK15462 | 493 | dipeptide/tripeptide permease D; Provisional | 95.39 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 95.31 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 95.31 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 95.29 | |
| PRK15034 | 462 | nitrate/nitrite transport protein NarU; Provisiona | 95.27 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 95.05 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 95.0 | |
| PRK11128 | 382 | putative 3-phenylpropionic acid transporter; Provi | 94.95 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 94.88 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 94.85 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 94.48 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 94.33 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 94.28 | |
| KOG0252|consensus | 538 | 94.07 | ||
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 94.01 | |
| KOG2816|consensus | 463 | 93.91 | ||
| KOG0569|consensus | 485 | 93.89 | ||
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 93.82 | |
| PF03825 | 400 | Nuc_H_symport: Nucleoside H+ symporter | 93.8 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 93.68 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 93.22 | |
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 93.21 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 93.08 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 92.97 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 92.8 | |
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 92.74 | |
| KOG3764|consensus | 464 | 92.68 | ||
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 92.55 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 92.41 | |
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 92.4 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 92.32 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 92.26 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 92.19 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 92.05 | |
| KOG0255|consensus | 521 | 91.82 | ||
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 91.76 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 91.65 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 91.49 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 91.47 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 91.39 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 91.3 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 91.05 | |
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 90.81 | |
| PRK10504 | 471 | putative transporter; Provisional | 90.73 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 90.66 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 90.37 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 89.47 | |
| PF03209 | 403 | PUCC: PUCC protein; InterPro: IPR004896 This prote | 88.95 | |
| KOG0253|consensus | 528 | 88.03 | ||
| KOG3626|consensus | 735 | 87.97 | ||
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 87.19 | |
| PF03092 | 433 | BT1: BT1 family; InterPro: IPR004324 Members of th | 87.08 | |
| KOG2325|consensus | 488 | 87.04 | ||
| PF13347 | 428 | MFS_2: MFS/sugar transport protein | 86.38 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 86.33 | |
| PRK03699 | 394 | putative transporter; Provisional | 86.28 | |
| KOG3762|consensus | 618 | 85.27 | ||
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 84.89 | |
| COG2807 | 395 | CynX Cyanate permease [Inorganic ion transport and | 84.78 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 84.69 | |
| KOG0254|consensus | 513 | 84.66 | ||
| PRK10054 | 395 | putative transporter; Provisional | 84.63 | |
| PRK11462 | 460 | putative transporter; Provisional | 83.42 | |
| TIGR01301 | 477 | GPH_sucrose GPH family sucrose/H+ symporter. This | 83.36 | |
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 83.19 | |
| COG0477 | 338 | ProP Permeases of the major facilitator superfamil | 82.97 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 82.9 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 82.78 | |
| PF06779 | 85 | DUF1228: Protein of unknown function (DUF1228); In | 81.59 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 81.1 | |
| TIGR00889 | 418 | 2A0110 nucleoside transporter. This family of prot | 80.36 |
| >KOG0569|consensus | Back alignment and domain information |
|---|
Probab=99.76 E-value=2e-18 Score=138.78 Aligned_cols=99 Identities=28% Similarity=0.359 Sum_probs=88.6
Q ss_pred CccchhHHHHHHhhcCcchhHHHHHHHHHHHHHHHHHHHHhhhh------hhHHHHHHHHHHHHHHHHHHHhhccCChHH
Q psy15865 2 AAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSF------LHWRSAAILNLLFPILALCALYFIPESPHW 75 (156)
Q Consensus 2 G~~~~~~~~~i~E~~~~~~Rg~~~~~~~~~~~~G~~l~~~~~~~------~~Wr~~~~~~~~~~~~~~~~~~~lpESp~~ 75 (156)
|......++|+.|++|.+.||..+++.+++..+|.+++..++.. ..|++.+.+..+++++.++..+++||||||
T Consensus 131 gl~~~~~pmyl~E~sP~~~RG~~g~~~~~~~~~g~ll~~~~~l~~ilGt~~~W~~l~~~~~i~~~~~l~~l~~~PESPk~ 210 (485)
T KOG0569|consen 131 GLSTGLVPMYLTEISPKNLRGALGTLLQIGVVIGILLGQVLGLPSLLGTEDLWPYLLAFPLIPALLQLALLPFLPESPKY 210 (485)
T ss_pred HHHHHHHHHHHhhcChhhhccHHHHHHHHHHHHHHHHHHHHccHHhcCCCcchHHHHHHHHHHHHHHHHHHhcCCCCcch
Confidence 45567899999999999999999999999999999999877653 479999999999999999999999999999
Q ss_pred HHH-hcChhhHhHHHHHHHHHHHHhhCCCCCCC
Q psy15865 76 LIS-KYLPIGLSALATSAKNMLLFSYGTTLGLP 107 (156)
Q Consensus 76 l~~-~~~~~~a~~~l~~a~~~l~~~~~~~~~~~ 107 (156)
|+. ||+.+| |++.++++|+...+..
T Consensus 211 Ll~~k~~~~~-------A~~sl~~y~G~~~~~~ 236 (485)
T KOG0569|consen 211 LLIKKGDEEE-------ARKALKFYRGKEDVEA 236 (485)
T ss_pred HHHHcCCHHH-------HHHHHHHHhCCCcchh
Confidence 998 788888 8999999999765444
|
|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >KOG0253|consensus | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >KOG0252|consensus | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2533|consensus | Back alignment and domain information |
|---|
| >PRK15403 multidrug efflux system protein MdtM; Provisional | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >TIGR00880 2_A_01_02 Multidrug resistance protein | Back alignment and domain information |
|---|
| >TIGR00901 2A0125 AmpG-related permease | Back alignment and domain information |
|---|
| >PRK11195 lysophospholipid transporter LplT; Provisional | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >PTZ00207 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >KOG2532|consensus | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >KOG2615|consensus | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1330|consensus | Back alignment and domain information |
|---|
| >TIGR00889 2A0110 nucleoside transporter | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00806 rfc RFC reduced folate carrier | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01272 gluP glucose/galactose transporter | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >PRK10133 L-fucose transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter | Back alignment and domain information |
|---|
| >PRK15462 dipeptide/tripeptide permease D; Provisional | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15034 nitrate/nitrite transport protein NarU; Provisional | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11128 putative 3-phenylpropionic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0252|consensus | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >KOG2816|consensus | Back alignment and domain information |
|---|
| >KOG0569|consensus | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PF03825 Nuc_H_symport: Nucleoside H+ symporter | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >KOG3764|consensus | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon | Back alignment and domain information |
|---|
| >KOG0253|consensus | Back alignment and domain information |
|---|
| >KOG3626|consensus | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins | Back alignment and domain information |
|---|
| >KOG2325|consensus | Back alignment and domain information |
|---|
| >PF13347 MFS_2: MFS/sugar transport protein | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >KOG3762|consensus | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11462 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >TIGR00889 2A0110 nucleoside transporter | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 99.49 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 98.15 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 98.11 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 97.92 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 97.66 | |
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 97.38 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 97.25 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 96.73 | |
| 2cfq_A | 417 | Lactose permease; transport, transport mechanism, | 95.96 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 95.84 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 94.21 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 89.58 | |
| 2cfq_A | 417 | Lactose permease; transport, transport mechanism, | 87.67 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 85.45 |
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
Probab=99.49 E-value=1.1e-13 Score=109.59 Aligned_cols=90 Identities=28% Similarity=0.466 Sum_probs=79.9
Q ss_pred CccchhHHHHHHhhcCcchhHHHHHHHHHHHHHHHHHHHHhhhh------------hhHHHHHHHHHHHHHHHHHHHhhc
Q psy15865 2 AAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSF------------LHWRSAAILNLLFPILALCALYFI 69 (156)
Q Consensus 2 G~~~~~~~~~i~E~~~~~~Rg~~~~~~~~~~~~G~~l~~~~~~~------------~~Wr~~~~~~~~~~~~~~~~~~~l 69 (156)
|+..+++++|++|++|++.|++..++.+.++.+|.++++++++. ..||+++.+..+++++.++.++++
T Consensus 141 G~~~~~~~~~i~E~~p~~~rg~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 220 (491)
T 4gc0_A 141 GLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTV 220 (491)
T ss_dssp HHHHHHHHHHHHTTSCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHHHHHHHHHHGGGS
T ss_pred HHHHHHHHHHHHhhCCHHhhhhhHHhhhhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhhhhhhhhhhhhcC
Confidence 56788999999999999999999999999999999998887653 379999999999999999999999
Q ss_pred cCChHHHHHhcChhhHhHHHHH
Q psy15865 70 PESPHWLISKYLPIGLSALATS 91 (156)
Q Consensus 70 pESp~~l~~~~~~~~a~~~l~~ 91 (156)
||||+|+..+++.+++.+.+++
T Consensus 221 peSp~~L~~~~~~~~a~~~l~~ 242 (491)
T 4gc0_A 221 PESPRWLMSRGKQEQAEGILRK 242 (491)
T ss_dssp CCCHHHHHHTTCHHHHHHHHHH
T ss_pred CCChHHHHHcCchhHHHHhHHH
Confidence 9999999999999995544443
|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 97.79 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 97.32 | |
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 96.17 |
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: MFS general substrate transporter superfamily: MFS general substrate transporter family: Glycerol-3-phosphate transporter domain: Glycerol-3-phosphate transporter species: Escherichia coli [TaxId: 562]
Probab=97.79 E-value=5.2e-06 Score=62.16 Aligned_cols=73 Identities=15% Similarity=0.124 Sum_probs=57.6
Q ss_pred ccchhHHHHHHhhcCcchhHHHHHHHHHHHHHHHHHHHHhhhh-----hhHHHHHHHHHHHHHHH-HHHHhhccCChHH
Q psy15865 3 APLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSF-----LHWRSAAILNLLFPILA-LCALYFIPESPHW 75 (156)
Q Consensus 3 ~~~~~~~~~i~E~~~~~~Rg~~~~~~~~~~~~G~~l~~~~~~~-----~~Wr~~~~~~~~~~~~~-~~~~~~lpESp~~ 75 (156)
...+....+++|+.|+++|++..++.+.+..+|.++++.++.. .+||+.+++.+++.++. ++.+++++|+|+.
T Consensus 132 ~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 210 (447)
T d1pw4a_ 132 MGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQS 210 (447)
T ss_dssp HTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTT
T ss_pred hhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccchhh
Confidence 4567788899999999999999999999999988877665442 48999999988876655 4455667777753
|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|