Psyllid ID: psy15865


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQTAGSGSLEKPAPGQIAPDGPPKNALTTNNNGV
cccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccc
ccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccccHHHHHHHHHccEEEccccccccccEEcccHHEEEEEcccccccccccccccccccccccccccccccccccc
MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCAlyfipesphwliskyLPIGLSALATSAKNMLLFSygttlglptiaipylsysikaipyqtagsgslekpapgqiapdgppknalttnnngv
MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQTAGSGSLEKPAPgqiapdgppknalttnnngv
MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQTAGSGSLEKPAPGQIAPDGPPKNALTTNNNGV
****LVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQ********************************
MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGL**LATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKA************************************
MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQTAGSGSLEKPAPGQIAPDGPPKNALTTNNNGV
*AAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQTAGSGSLEK*******PDGPPKNA********
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFIPESPHWLISKYLPIGLSALATSAKNMLLFSYGTTLGLPTIAIPYLSYSIKAIPYQTAGSGSLEKPAPGQIAPDGPPKNALTTNNNGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
Q9SCW7 464 Sugar transporter ERD6-li yes N/A 0.429 0.144 0.402 5e-08
Q4F7G0 462 Sugar transporter ERD6-li no N/A 0.557 0.188 0.329 1e-07
Q8VZT3 462 Sugar transporter ERD6-li no N/A 0.448 0.151 0.371 1e-07
Q7XA64327 Sugar transporter ERD6-li no N/A 0.429 0.204 0.358 2e-07
Q94CI7 474 Sugar transporter ERD6-li no N/A 0.423 0.139 0.378 4e-07
Q94CI6 478 Sugar transporter ERD6-li no N/A 0.429 0.140 0.388 4e-07
Q94AF9 467 Sugar transporter ERD6-li no N/A 0.429 0.143 0.373 5e-07
Q93Z80 458 Sugar transporter ERD6-li no N/A 0.429 0.146 0.388 8e-07
Q3ECP7 470 Sugar transporter ERD6-li no N/A 0.429 0.142 0.358 1e-06
B3NSE1 856 Facilitated trehalose tra N/A N/A 0.423 0.077 0.347 2e-06
>sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 Back     alignment and function desciption
 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (56%)

Query: 10  TYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALYFI 69
            Y+AEIT    RG  S +  +   FG     F G+F HWR+ A+L+ +   + +  L+FI
Sbjct: 140 VYIAEITPKAFRGGFSFSNQLLQSFGISLMFFTGNFFHWRTLALLSAIPCGIQMICLFFI 199

Query: 70  PESPHWL 76
           PESP WL
Sbjct: 200 PESPRWL 206




Sugar transporter.
Arabidopsis thaliana (taxid: 3702)
>sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 Back     alignment and function description
>sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 Back     alignment and function description
>sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 Back     alignment and function description
>sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 Back     alignment and function description
>sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 Back     alignment and function description
>sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
357619316 540 putative sugar transporter [Danaus plexi 0.455 0.131 0.583 7e-19
307176944 517 Sugar transporter ERD6-like 6 [Camponotu 0.461 0.139 0.597 7e-19
332016797 531 Sugar transporter ERD6-like 2 [Acromyrme 0.461 0.135 0.597 7e-19
291461585 544 sugar transporter 13 [Nilaparvata lugens 0.461 0.132 0.652 8e-19
242020658 545 conserved hypothetical protein [Pediculu 0.461 0.132 0.597 1e-18
193688235 560 PREDICTED: facilitated trehalose transpo 0.461 0.128 0.569 2e-18
91082977 1252 PREDICTED: similar to sugar transporter 0.461 0.057 0.611 2e-18
270007037 1229 hypothetical protein TcasGA2_TC013484 [T 0.461 0.058 0.611 3e-18
307207615 526 Sugar transporter ERD6-like 7 [Harpegnat 0.461 0.136 0.583 1e-17
322800186 588 hypothetical protein SINV_08656 [Solenop 0.461 0.122 0.583 1e-17
>gi|357619316|gb|EHJ71940.1| putative sugar transporter [Danaus plexippus] Back     alignment and taxonomy information
 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (77%)

Query: 8   VLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPILALCALY 67
           VLTYVAEITQPHLRG L+AT+SM  I G  +Q   G  ++WR+ A++N+ F ++A+ AL+
Sbjct: 141 VLTYVAEITQPHLRGALTATSSMCIIIGVFTQFLFGLLMYWRTVALVNIFFALIAILALF 200

Query: 68  FIPESPHWLISK 79
           FIPESPHWL+ K
Sbjct: 201 FIPESPHWLVMK 212




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307176944|gb|EFN66250.1| Sugar transporter ERD6-like 6 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332016797|gb|EGI57618.1| Sugar transporter ERD6-like 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|291461585|dbj|BAI83427.1| sugar transporter 13 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|242020658|ref|XP_002430769.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212515966|gb|EEB18031.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|193688235|ref|XP_001945235.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91082977|ref|XP_974017.1| PREDICTED: similar to sugar transporter [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270007037|gb|EFA03485.1| hypothetical protein TcasGA2_TC013484 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307207615|gb|EFN85275.1| Sugar transporter ERD6-like 7 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322800186|gb|EFZ21271.1| hypothetical protein SINV_08656 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
FB|FBgn0051100 716 CG31100 [Drosophila melanogast 0.474 0.103 0.506 1.2e-13
TAIR|locus:2079802 462 AT3G05400 [Arabidopsis thalian 0.467 0.158 0.369 7.4e-10
TAIR|locus:2036039 464 AT1G08890 [Arabidopsis thalian 0.448 0.150 0.4 8.9e-09
TAIR|locus:504955729327 AT3G05155 [Arabidopsis thalian 0.448 0.214 0.357 1.2e-08
TAIR|locus:2096234 458 AT3G05160 [Arabidopsis thalian 0.448 0.152 0.385 1.8e-08
TAIR|locus:2036009 462 AT1G08900 [Arabidopsis thalian 0.448 0.151 0.385 1.9e-08
TAIR|locus:2146365 478 SFP2 [Arabidopsis thaliana (ta 0.448 0.146 0.385 2e-08
TAIR|locus:2146350 474 SFP1 [Arabidopsis thaliana (ta 0.448 0.147 0.371 3.2e-08
TAIR|locus:505006329 467 AT3G05165 [Arabidopsis thalian 0.448 0.149 0.371 5.1e-08
TAIR|locus:2025132 487 ERDL6 "ERD6-like 6" [Arabidops 0.442 0.141 0.391 7e-08
FB|FBgn0051100 CG31100 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 188 (71.2 bits), Expect = 1.2e-13, P = 1.2e-13
 Identities = 39/77 (50%), Positives = 49/77 (63%)

Query:     1 MAAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSFLHWRSAAILNLLFPI 60
             M AP   VLTYVAEIT+P  RG+LSA  +   I G   Q  LGS + WRS A ++  FP+
Sbjct:   166 MEAP---VLTYVAEITEPKYRGILSALGTTCVITGVFIQFILGSLMDWRSVAAVSSAFPV 222

Query:    61 LALCALYFIPESPHWLI 77
             + +  L F+PESP WLI
Sbjct:   223 ITIIMLCFVPESPVWLI 239




GO:0016021 "integral to membrane" evidence=ISS
GO:0015145 "monosaccharide transmembrane transporter activity" evidence=ISS
GO:0015749 "monosaccharide transport" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
TAIR|locus:2079802 AT3G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036039 AT1G08890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955729 AT3G05155 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096234 AT3G05160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036009 AT1G08900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146365 SFP2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146350 SFP1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006329 AT3G05165 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025132 ERDL6 "ERD6-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 1e-08
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 2e-06
PRK10077 479 PRK10077, xylE, D-xylose transporter XylE; Provisi 3e-05
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
 Score = 52.0 bits (125), Expect = 1e-08
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 6   VLVLTYVAEITQPHLRGMLSATASMTTIFG-------TVSQLFLGSFLHWRSAAILNLLF 58
            LV  Y++EI    LRG L++   +   FG          ++ L + L WR    L L+ 
Sbjct: 146 ALVPMYLSEIAPKALRGALTSLYQLAITFGILVAYGFGSGKVSLNNTLGWRIPLGLQLIP 205

Query: 59  PILALCALYFIPESPHWLISKY 80
             L    L+F+PESP WL+ K 
Sbjct: 206 AGLLFLGLFFLPESPRWLVGKG 227


This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481

>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
KOG0569|consensus 485 99.76
KOG0254|consensus 513 99.6
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.57
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.56
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.51
KOG0253|consensus 528 99.41
KOG0255|consensus 521 99.37
TIGR00898 505 2A0119 cation transport protein. 99.34
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.27
PRK10642 490 proline/glycine betaine transporter; Provisional 99.02
PRK10642490 proline/glycine betaine transporter; Provisional 99.01
PRK09952 438 shikimate transporter; Provisional 98.94
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 98.89
PRK10406 432 alpha-ketoglutarate transporter; Provisional 98.77
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.58
KOG0252|consensus 538 98.49
TIGR00891 405 2A0112 putative sialic acid transporter. 98.48
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.46
PRK15075 434 citrate-proton symporter; Provisional 98.31
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 98.25
PRK12307 426 putative sialic acid transporter; Provisional 98.23
TIGR00895 398 2A0115 benzoate transport. 98.17
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 98.16
PRK11663 434 regulatory protein UhpC; Provisional 98.06
PRK03893 496 putative sialic acid transporter; Provisional 98.05
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 97.92
KOG2533|consensus 495 97.87
PRK15403 413 multidrug efflux system protein MdtM; Provisional 97.87
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.87
PRK11010 491 ampG muropeptide transporter; Validated 97.86
PRK03545 390 putative arabinose transporter; Provisional 97.86
TIGR00893 399 2A0114 d-galactonate transporter. 97.86
PRK10213 394 nepI ribonucleoside transporter; Reviewed 97.81
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 97.79
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.77
TIGR00901356 2A0125 AmpG-related permease. 97.74
PRK11195 393 lysophospholipid transporter LplT; Provisional 97.73
PRK11902 402 ampG muropeptide transporter; Reviewed 97.73
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.71
TIGR00805 633 oat sodium-independent organic anion transporter. 97.68
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 97.67
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.67
PTZ00207 591 hypothetical protein; Provisional 97.66
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 97.63
PRK10091 382 MFS transport protein AraJ; Provisional 97.56
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.55
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 97.55
TIGR00900365 2A0121 H+ Antiporter protein. 97.55
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.51
PRK10473 392 multidrug efflux system protein MdtL; Provisional 97.38
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 97.35
PRK10489 417 enterobactin exporter EntS; Provisional 97.33
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 97.3
KOG2532|consensus 466 97.28
PLN00028 476 nitrate transmembrane transporter; Provisional 97.27
KOG2615|consensus 451 97.26
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.26
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 97.26
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 97.24
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 97.24
KOG1330|consensus 493 97.22
TIGR00889418 2A0110 nucleoside transporter. This family of prot 97.21
PRK12382 392 putative transporter; Provisional 97.19
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.14
PRK05122 399 major facilitator superfamily transporter; Provisi 97.11
PRK10504 471 putative transporter; Provisional 97.1
PRK10077479 xylE D-xylose transporter XylE; Provisional 97.08
PRK11646 400 multidrug resistance protein MdtH; Provisional 97.04
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 97.03
PRK09874 408 drug efflux system protein MdtG; Provisional 97.01
TIGR00898505 2A0119 cation transport protein. 96.99
PRK15011393 sugar efflux transporter B; Provisional 96.97
PRK11652 394 emrD multidrug resistance protein D; Provisional 96.96
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 96.93
PRK03699 394 putative transporter; Provisional 96.89
PRK11043 401 putative transporter; Provisional 96.86
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.84
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 96.74
PRK10207 489 dipeptide/tripeptide permease B; Provisional 96.71
PRK10054 395 putative transporter; Provisional 96.7
PRK05122399 major facilitator superfamily transporter; Provisi 96.67
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 96.67
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 96.67
PRK15011 393 sugar efflux transporter B; Provisional 96.6
TIGR00892 455 2A0113 monocarboxylate transporter 1. 96.59
TIGR00892455 2A0113 monocarboxylate transporter 1. 96.55
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 96.53
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 96.51
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 96.38
TIGR00893399 2A0114 d-galactonate transporter. 96.35
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 96.33
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 96.29
PRK12382392 putative transporter; Provisional 96.24
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 96.11
PRK09584 500 tppB putative tripeptide transporter permease; Rev 96.02
PRK10133 438 L-fucose transporter; Provisional 95.94
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 95.93
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 95.92
PRK09952438 shikimate transporter; Provisional 95.91
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 95.87
PRK09705 393 cynX putative cyanate transporter; Provisional 95.75
PRK09528420 lacY galactoside permease; Reviewed 95.75
PRK03633381 putative MFS family transporter protein; Provision 95.61
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 95.39
PRK15462 493 dipeptide/tripeptide permease D; Provisional 95.39
PRK09874408 drug efflux system protein MdtG; Provisional 95.31
TIGR00896355 CynX cyanate transporter. This family of proteins 95.31
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 95.29
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 95.27
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 95.05
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 95.0
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 94.95
PRK10489417 enterobactin exporter EntS; Provisional 94.88
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 94.85
TIGR00897 402 2A0118 polyol permease family. This family of prot 94.48
PRK11010491 ampG muropeptide transporter; Validated 94.33
PRK03893496 putative sialic acid transporter; Provisional 94.28
KOG0252|consensus538 94.07
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 94.01
KOG2816|consensus 463 93.91
KOG0569|consensus485 93.89
PRK09705393 cynX putative cyanate transporter; Provisional 93.82
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 93.8
PRK11663434 regulatory protein UhpC; Provisional 93.68
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 93.22
TIGR00788 468 fbt folate/biopterin transporter. The only functio 93.21
PRK09584500 tppB putative tripeptide transporter permease; Rev 93.08
PRK12307426 putative sialic acid transporter; Provisional 92.97
PRK03633 381 putative MFS family transporter protein; Provision 92.8
TIGR00788468 fbt folate/biopterin transporter. The only functio 92.74
KOG3764|consensus 464 92.68
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 92.55
PRK03545390 putative arabinose transporter; Provisional 92.41
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 92.4
TIGR00897402 2A0118 polyol permease family. This family of prot 92.32
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 92.26
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 92.19
PRK10406432 alpha-ketoglutarate transporter; Provisional 92.05
KOG0255|consensus521 91.82
PRK11646400 multidrug resistance protein MdtH; Provisional 91.76
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 91.65
PRK11902402 ampG muropeptide transporter; Reviewed 91.49
TIGR00891405 2A0112 putative sialic acid transporter. 91.47
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 91.39
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 91.3
PRK09528 420 lacY galactoside permease; Reviewed 91.05
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 90.81
PRK10504471 putative transporter; Provisional 90.73
TIGR00881379 2A0104 phosphoglycerate transporter family protein 90.66
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 90.37
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 89.47
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 88.95
KOG0253|consensus528 88.03
KOG3626|consensus 735 87.97
TIGR00902382 2A0127 phenyl proprionate permease family protein. 87.19
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 87.08
KOG2325|consensus 488 87.04
PF13347 428 MFS_2: MFS/sugar transport protein 86.38
PLN00028476 nitrate transmembrane transporter; Provisional 86.33
PRK03699394 putative transporter; Provisional 86.28
KOG3762|consensus618 85.27
PRK10207489 dipeptide/tripeptide permease B; Provisional 84.89
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 84.78
PRK09669 444 putative symporter YagG; Provisional 84.69
KOG0254|consensus513 84.66
PRK10054395 putative transporter; Provisional 84.63
PRK11462 460 putative transporter; Provisional 83.42
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 83.36
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 83.19
COG0477338 ProP Permeases of the major facilitator superfamil 82.97
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 82.9
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 82.78
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 81.59
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 81.1
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 80.36
>KOG0569|consensus Back     alignment and domain information
Probab=99.76  E-value=2e-18  Score=138.78  Aligned_cols=99  Identities=28%  Similarity=0.359  Sum_probs=88.6

Q ss_pred             CccchhHHHHHHhhcCcchhHHHHHHHHHHHHHHHHHHHHhhhh------hhHHHHHHHHHHHHHHHHHHHhhccCChHH
Q psy15865          2 AAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSF------LHWRSAAILNLLFPILALCALYFIPESPHW   75 (156)
Q Consensus         2 G~~~~~~~~~i~E~~~~~~Rg~~~~~~~~~~~~G~~l~~~~~~~------~~Wr~~~~~~~~~~~~~~~~~~~lpESp~~   75 (156)
                      |......++|+.|++|.+.||..+++.+++..+|.+++..++..      ..|++.+.+..+++++.++..+++||||||
T Consensus       131 gl~~~~~pmyl~E~sP~~~RG~~g~~~~~~~~~g~ll~~~~~l~~ilGt~~~W~~l~~~~~i~~~~~l~~l~~~PESPk~  210 (485)
T KOG0569|consen  131 GLSTGLVPMYLTEISPKNLRGALGTLLQIGVVIGILLGQVLGLPSLLGTEDLWPYLLAFPLIPALLQLALLPFLPESPKY  210 (485)
T ss_pred             HHHHHHHHHHHhhcChhhhccHHHHHHHHHHHHHHHHHHHHccHHhcCCCcchHHHHHHHHHHHHHHHHHHhcCCCCcch
Confidence            45567899999999999999999999999999999999877653      479999999999999999999999999999


Q ss_pred             HHH-hcChhhHhHHHHHHHHHHHHhhCCCCCCC
Q psy15865         76 LIS-KYLPIGLSALATSAKNMLLFSYGTTLGLP  107 (156)
Q Consensus        76 l~~-~~~~~~a~~~l~~a~~~l~~~~~~~~~~~  107 (156)
                      |+. ||+.+|       |++.++++|+...+..
T Consensus       211 Ll~~k~~~~~-------A~~sl~~y~G~~~~~~  236 (485)
T KOG0569|consen  211 LLIKKGDEEE-------ARKALKFYRGKEDVEA  236 (485)
T ss_pred             HHHHcCCHHH-------HHHHHHHHhCCCcchh
Confidence            998 788888       8999999999765444



>KOG0254|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.49
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 98.15
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.11
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 97.92
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 97.66
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 97.38
2xut_A 524 Proton/peptide symporter family protein; transport 97.25
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 96.73
2cfq_A417 Lactose permease; transport, transport mechanism, 95.96
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 95.84
2xut_A524 Proton/peptide symporter family protein; transport 94.21
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 89.58
2cfq_A 417 Lactose permease; transport, transport mechanism, 87.67
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 85.45
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.49  E-value=1.1e-13  Score=109.59  Aligned_cols=90  Identities=28%  Similarity=0.466  Sum_probs=79.9

Q ss_pred             CccchhHHHHHHhhcCcchhHHHHHHHHHHHHHHHHHHHHhhhh------------hhHHHHHHHHHHHHHHHHHHHhhc
Q psy15865          2 AAPLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSF------------LHWRSAAILNLLFPILALCALYFI   69 (156)
Q Consensus         2 G~~~~~~~~~i~E~~~~~~Rg~~~~~~~~~~~~G~~l~~~~~~~------------~~Wr~~~~~~~~~~~~~~~~~~~l   69 (156)
                      |+..+++++|++|++|++.|++..++.+.++.+|.++++++++.            ..||+++.+..+++++.++.++++
T Consensus       141 G~~~~~~~~~i~E~~p~~~rg~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  220 (491)
T 4gc0_A          141 GLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECIPALLFLMLLYTV  220 (491)
T ss_dssp             HHHHHHHHHHHHTTSCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHHHHHHHHHHGGGS
T ss_pred             HHHHHHHHHHHHhhCCHHhhhhhHHhhhhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhhhhhhhhhhhhcC
Confidence            56788999999999999999999999999999999998887653            379999999999999999999999


Q ss_pred             cCChHHHHHhcChhhHhHHHHH
Q psy15865         70 PESPHWLISKYLPIGLSALATS   91 (156)
Q Consensus        70 pESp~~l~~~~~~~~a~~~l~~   91 (156)
                      ||||+|+..+++.+++.+.+++
T Consensus       221 peSp~~L~~~~~~~~a~~~l~~  242 (491)
T 4gc0_A          221 PESPRWLMSRGKQEQAEGILRK  242 (491)
T ss_dssp             CCCHHHHHHTTCHHHHHHHHHH
T ss_pred             CCChHHHHHcCchhHHHHhHHH
Confidence            9999999999999995544443



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 97.79
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.32
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 96.17
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=97.79  E-value=5.2e-06  Score=62.16  Aligned_cols=73  Identities=15%  Similarity=0.124  Sum_probs=57.6

Q ss_pred             ccchhHHHHHHhhcCcchhHHHHHHHHHHHHHHHHHHHHhhhh-----hhHHHHHHHHHHHHHHH-HHHHhhccCChHH
Q psy15865          3 APLVLVLTYVAEITQPHLRGMLSATASMTTIFGTVSQLFLGSF-----LHWRSAAILNLLFPILA-LCALYFIPESPHW   75 (156)
Q Consensus         3 ~~~~~~~~~i~E~~~~~~Rg~~~~~~~~~~~~G~~l~~~~~~~-----~~Wr~~~~~~~~~~~~~-~~~~~~lpESp~~   75 (156)
                      ...+....+++|+.|+++|++..++.+.+..+|.++++.++..     .+||+.+++.+++.++. ++.+++++|+|+.
T Consensus       132 ~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~  210 (447)
T d1pw4a_         132 MGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMRDTPQS  210 (447)
T ss_dssp             HTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCCCSSTT
T ss_pred             hhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcccchhh
Confidence            4567788899999999999999999999999988877665442     48999999988876655 4455667777753



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure