Diaphorina citri psyllid: psy158


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MFVFIYSMPGYSLPIKERMLYSSCKAPLLENLHHLGLTIDKKLKKKKKKKKKKKKKKKFPYNSGSELTEEFLLEELHPKKTAERPKFDKPKGPPNRGAKRITKPQATPQFVKKLVD
cEEEEEEcccccccccHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcc
MFVFIYSMPGYSLPIKERMLYSSCKAPLLENLHHLGLTIDKKLKKKKKKKKK**********************************************************VKKLV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVFIYSMPGYSLPIKERMLYSSCKAPLLENLHHLGLTIDKKLKKKKKKKKKKKKKKKFPYNSGSELTEEFLLEELHPKKTAERPKFDKPKGPPNRGAKRITKPQATPQFVKKLVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Twinfilin Actin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin.confidentQ7QG28
Twinfilin Actin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin.confidentQ9VFM9
Twinfilin Actin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin.confidentQ298X4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DAW, chain B
Confidence level:very confident
Coverage over the Query: 2-44,61-79
View the alignment between query and template
View the model in PyMOL