Diaphorina citri psyllid: psy15902

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MSALTDIRTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIESSQLLDVDGLIESS
cccccccccccEEEEEccccccccccEEEEECcccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccc
******IRTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIESSQLLDV*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSALTDIRTQHFQVENFTISRCFVGEKICYYDLSQDEELFEGEGDYQFDMYRMMRKQCQNNWQNFTPKNNALDIDGLIESSQLLDVDGLIESS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative serine/threonine-protein kinase haspin homolog confidentP83103

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VUW, chain A
Confidence level:very confident
Coverage over the Query: 9-80
View the alignment between query and template
View the model in PyMOL