Diaphorina citri psyllid: psy15905


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MQPIPAKPLFFDLAQNQLEFPSLEDKLDVKIKPAAGGGSGQPAGISGFVKGLWGWGGAKK
cccccccccHHHHHcccccccccccccccccccccccccccccccEEccEEEEccccccc
**PIPAKPLFFDLAQNQLEFPS********************AGISGFVKGLWGWGG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQPIPAKPLFFDLAQNQLEFPSLEDKLDVKIKPAAGGGSGQPAGISGFVKGLWGWGGAKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 68 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. Srp68 binds the 7S RNA, Srp72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.confidentQ9VSS2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005786 [CC]signal recognition particle, endoplasmic reticulum targetingprobableGO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0048500, GO:0044424, GO:0005622
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006614 [BP]SRP-dependent cotranslational protein targeting to membraneprobableGO:0008104, GO:0006613, GO:0006612, GO:0044699, GO:0070972, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0045047, GO:0033365, GO:0044763, GO:0009987
GO:0030942 [MF]endoplasmic reticulum signal peptide bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0005048, GO:0005488
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008312 [MF]7S RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005047 [MF]signal recognition particle bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted