Diaphorina citri psyllid: psy15918

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------

MKVTKFEDPASPVQRYNDFRVSQEDFRRSHTPELLHQNPRSPHQTMLSLTSCSDNDLSDVDHEYMSDVDVTGDVDVTGDASPLDCSNKKSSEDNNASSEESKANEEGKPKECKKDEKPPYSYNALIMMAIRQSPEKRLTLNGIYEYIMTNFPYYKTNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDASSEDVFIGGTTGKLRRRTTAASRSRLAAFKRSAVFGAAAAGIYPPGFIPTATPGSYPPPSWALQQLYCNPLYRYNPYAYPGLQAAAIPKPTPLPAHGGAFSMERLLADPATFRPNFVQTSPILYQMMNNLRDSHNQAMRESQQNSQPCRMTSPASSCSSSPEPIIRQNLYRPEAVLARPPS

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHcccHHHHHccccccccccccccccccccccccccccccccccccccccc

************************************************************************************************************************SYNALIMMAIRQSPEKRLTLNGIYEYIMTNFPYYKTNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDASSEDVFIGGTTGK*****************************************************************YPGLQAAAIPKPTPLPAHGGAFSMERLLADPATFRPNFVQTSPILYQM*******************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0072001 [BP]	renal system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0001655, GO:0048731, GO:0007275, GO:0044699
GO:0044212 [MF]	transcription regulatory region DNA binding	probable	GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0043565 [MF]	sequence-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0048598 [BP]	embryonic morphogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0009887 [BP]	organ morphogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0030182 [BP]	neuron differentiation	probable	GO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0048468 [BP]	cell development	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0048646 [BP]	anatomical structure formation involved in morphogenesis	probable	GO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0048729 [BP]	tissue morphogenesis	probable	GO:0032502, GO:0048856, GO:0009888, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0000981 [MF]	sequence-specific DNA binding RNA polymerase II transcription factor activity	probable	GO:0003700, GO:0003674, GO:0001071
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0060429 [BP]	epithelium development	probable	GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0043009 [BP]	chordate embryonic development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C6Y, chain A
Confidence level:very confident
Coverage over the Query: 115-212
View the alignment between query and template
View the model in PyMOL