Diaphorina citri psyllid: psy15934


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70
MVTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVALI
ccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccc
*****IANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVAL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVALI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SH3 and multiple ankyrin repeat domains protein 1 Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors, and the actin-based cytoskeleton. Plays a role in the structural and functional organization of the dendritic spine and synaptic junction. Overexpression promotes maturation of dendritic spines and the enlargement of spine heads via its ability to recruit Homer to postsynaptic sites, and enhances presynaptic function.confidentD3YZU1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017124 [MF]SH3 domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0060999 [BP]positive regulation of dendritic spine developmentprobableGO:0044707, GO:0010975, GO:0030154, GO:0051128, GO:0031344, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0050789, GO:0045664, GO:0060998, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0050773, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0060074 [BP]synapse maturationprobableGO:0032502, GO:0050808, GO:0044707, GO:0007399, GO:0008150, GO:0009987, GO:0016043, GO:0044767, GO:0032501, GO:0044763, GO:0071840, GO:0048731, GO:0010259, GO:0007275, GO:0044699, GO:0048856
GO:0060076 [CC]excitatory synapseprobableGO:0005575, GO:0045202
GO:0050890 [BP]cognitionprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0044708 [BP]single-organism behaviorprobableGO:0050896, GO:0008150, GO:0007610
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0030160 [MF]GKAP/Homer scaffold activityprobableGO:0030159, GO:0005198, GO:0003674, GO:0005488, GO:0005515, GO:0032947
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0032232 [BP]negative regulation of actin filament bundle assemblyprobableGO:0032231, GO:0032970, GO:0033043, GO:0051494, GO:0051493, GO:0010639, GO:0051129, GO:0050794, GO:0008150, GO:0044087, GO:0065007, GO:0044763, GO:0044699, GO:0032956, GO:0048519, GO:0009987, GO:0051128, GO:0050789, GO:0048523
GO:0060170 [CC]cilium membraneprobableGO:0043229, GO:0071944, GO:0005929, GO:0043227, GO:0043226, GO:0044446, GO:0031090, GO:0031514, GO:0016020, GO:0044459, GO:0031253, GO:0005886, GO:0042995, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044441, GO:0044424, GO:0044425, GO:0044422
GO:0007416 [BP]synapse assemblyprobableGO:0032502, GO:0050808, GO:0044707, GO:0007399, GO:0032501, GO:0009987, GO:0048856, GO:0016043, GO:0008150, GO:0022607, GO:0044763, GO:0071840, GO:0048731, GO:0007275, GO:0044699, GO:0044085
GO:0017146 [CC]N-methyl-D-aspartate selective glutamate receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0008328, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y1L, chain E
Confidence level:confident
Coverage over the Query: 29-69
View the alignment between query and template
View the model in PyMOL