Psyllid ID: psy15934

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70
MVTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVALI
ccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccc
ccEEEcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccEEEEc
MVTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAkgldpnfhcpetgemvali
MVTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVALI
MVTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVALI
*****IANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHC**********
*******NTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVAL*
MVTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVALI
*VTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVALI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTSNIANTFISLLLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVALI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query70 2.2.26 [Sep-21-2011]
Q9WV48 2167 SH3 and multiple ankyrin no N/A 0.714 0.023 0.58 3e-11
D3YZU1 2167 SH3 and multiple ankyrin yes N/A 0.714 0.023 0.58 3e-11
Q9Y566 2161 SH3 and multiple ankyrin no N/A 0.714 0.023 0.58 3e-11
Q9JLU4 1815 SH3 and multiple ankyrin no N/A 0.7 0.026 0.530 5e-11
Q4ACU6 1805 SH3 and multiple ankyrin no N/A 0.7 0.027 0.530 5e-11
Q9BYB0 1741 SH3 and multiple ankyrin no N/A 0.7 0.028 0.530 5e-11
>sp|Q9WV48|SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 OS=Rattus norvegicus GN=Shank1 PE=1 SV=1 Back     alignment and function desciption
 Score = 67.0 bits (162), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 38/50 (76%)

Query: 16  NLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGE 65
           NLDEKQL  LHT++ LK+FLEYV     +K+A+L  KGLDPN+H  ++GE
Sbjct: 165 NLDEKQLAKLHTKTGLKKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGE 214
Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors, and the actin-based cytoskeleton. Plays a role in the structural and functional organization of the dendritic spine and synaptic junction. Overexpression promotes maturation of dendritic spines and the enlargement of spine heads via its ability to recruit Homer to postsynaptic sites, and enhances presynaptic function.
Rattus norvegicus (taxid: 10116)
>sp|D3YZU1|SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus GN=Shank1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 OS=Homo sapiens GN=SHANK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9JLU4|SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus GN=Shank3 PE=1 SV=2 Back     alignment and function description
>sp|Q4ACU6|SHAN3_MOUSE SH3 and multiple ankyrin repeat domains protein 3 OS=Mus musculus GN=Shank3 PE=1 SV=2 Back     alignment and function description
>sp|Q9BYB0|SHAN3_HUMAN SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens GN=SHANK3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
383852097 1688 PREDICTED: uncharacterized protein LOC10 0.742 0.030 0.807 5e-19
350415640 1643 PREDICTED: hypothetical protein LOC10074 0.742 0.031 0.807 7e-19
328789715 1592 PREDICTED: hypothetical protein LOC72646 0.742 0.032 0.807 7e-19
380026582 1456 PREDICTED: uncharacterized protein LOC10 0.742 0.035 0.807 7e-19
340728717 1564 PREDICTED: hypothetical protein LOC10064 0.742 0.033 0.807 7e-19
170047682 380 conserved hypothetical protein [Culex qu 0.742 0.136 0.788 8e-19
340728715 1476 PREDICTED: hypothetical protein LOC10064 0.742 0.035 0.807 9e-19
312385689 1504 hypothetical protein AND_00472 [Anophele 0.742 0.034 0.788 9e-19
158289915 1271 AGAP010413-PA [Anopheles gambiae str. PE 0.742 0.040 0.788 9e-19
157105581 1191 hypothetical protein AaeL_AAEL004337 [Ae 0.742 0.043 0.769 2e-18
>gi|383852097|ref|XP_003701565.1| PREDICTED: uncharacterized protein LOC100883912 [Megachile rotundata] Back     alignment and taxonomy information
 Score = 98.2 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 42/52 (80%), Positives = 49/52 (94%)

Query: 14  LLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGE 65
           +L+LDEKQLKA+HTR+NL+R LEYV NSQVEKIAK+C+KGLDPNFHC ETGE
Sbjct: 185 MLHLDEKQLKAMHTRTNLRRLLEYVANSQVEKIAKMCSKGLDPNFHCQETGE 236

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350415640|ref|XP_003490703.1| PREDICTED: hypothetical protein LOC100747251 [Bombus impatiens] Back     alignment and taxonomy information
>gi|328789715|ref|XP_001122193.2| PREDICTED: hypothetical protein LOC726461 [Apis mellifera] Back     alignment and taxonomy information
>gi|380026582|ref|XP_003697027.1| PREDICTED: uncharacterized protein LOC100872665 [Apis florea] Back     alignment and taxonomy information
>gi|340728717|ref|XP_003402664.1| PREDICTED: hypothetical protein LOC100643024 isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|170047682|ref|XP_001851342.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167870023|gb|EDS33406.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|340728715|ref|XP_003402663.1| PREDICTED: hypothetical protein LOC100643024 isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|312385689|gb|EFR30120.1| hypothetical protein AND_00472 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158289915|ref|XP_311535.4| AGAP010413-PA [Anopheles gambiae str. PEST] gi|157018388|gb|EAA07141.5| AGAP010413-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157105581|ref|XP_001648932.1| hypothetical protein AaeL_AAEL004337 [Aedes aegypti] gi|108880054|gb|EAT44279.1| AAEL004337-PA, partial [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
FB|FBgn0040752 1871 Prosap "Prosap" [Drosophila me 0.742 0.027 0.730 5.8e-16
UNIPROTKB|F1NWF9 288 F1NWF9 "Uncharacterized protei 0.714 0.173 0.58 4.6e-12
UNIPROTKB|C9JFP8 304 SHANK2 "SH3 and multiple ankyr 0.714 0.164 0.58 1.3e-11
WB|WBGene00006444 1140 shn-1 [Caenorhabditis elegans 0.657 0.040 0.586 1.8e-10
UNIPROTKB|B7WN72 1140 shn-1 "Protein SHN-1, isoform 0.657 0.040 0.586 1.8e-10
UNIPROTKB|A6NHU9 1850 SHANK2 "SH3 and multiple ankyr 0.714 0.027 0.58 2.5e-10
UNIPROTKB|G3X7P4 1697 SHANK3 "Uncharacterized protei 0.7 0.028 0.571 2.8e-10
UNIPROTKB|I3LCT5 1208 I3LCT5 "Uncharacterized protei 0.7 0.040 0.551 4e-10
UNIPROTKB|E1C3V2 1841 SHANK2 "Uncharacterized protei 0.714 0.027 0.56 6.5e-10
UNIPROTKB|G5E618 2084 SHANK1 "Uncharacterized protei 0.714 0.023 0.58 1.2e-09
FB|FBgn0040752 Prosap "Prosap" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 215 (80.7 bits), Expect = 5.8e-16, P = 5.8e-16
 Identities = 38/52 (73%), Positives = 46/52 (88%)

Query:    14 LLNLDEKQLKALHTRSNLKRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGE 65
             +L LDE+QLKALHTR+NL+RFLE +N   VEKIAK+CAKGLDPNFHC E+G+
Sbjct:   108 MLTLDERQLKALHTRANLRRFLECINGGHVEKIAKMCAKGLDPNFHCSESGD 159
GO:0005515 "protein binding" evidence=IPI
GO:0030160 "GKAP/Homer scaffold activity" evidence=ISS
GO:0097107 "postsynaptic density assembly" evidence=ISS
GO:0014069 "postsynaptic density" evidence=ISS
UNIPROTKB|F1NWF9 F1NWF9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|C9JFP8 SHANK2 "SH3 and multiple ankyrin repeat domains protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00006444 shn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|B7WN72 shn-1 "Protein SHN-1, isoform c" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A6NHU9 SHANK2 "SH3 and multiple ankyrin repeat domains protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3X7P4 SHANK3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCT5 I3LCT5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3V2 SHANK2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G5E618 SHANK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
D3YZU1SHAN1_MOUSENo assigned EC number0.580.71420.0230yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 70
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.32
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 97.95
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 97.74
PHA02875 413 ankyrin repeat protein; Provisional 97.38
PHA02878 477 ankyrin repeat protein; Provisional 97.22
KOG0818|consensus 669 97.1
PHA03095 471 ankyrin-like protein; Provisional 97.06
PHA02798 489 ankyrin-like protein; Provisional 97.02
PHA02989 494 ankyrin repeat protein; Provisional 96.86
PHA02875 413 ankyrin repeat protein; Provisional 96.8
KOG0514|consensus452 96.78
TIGR00870 743 trp transient-receptor-potential calcium channel p 96.77
PHA03100 480 ankyrin repeat protein; Provisional 96.71
PLN03192 823 Voltage-dependent potassium channel; Provisional 96.7
PHA02743166 Viral ankyrin protein; Provisional 96.68
PHA02874 434 ankyrin repeat protein; Provisional 96.65
PF1360630 Ank_3: Ankyrin repeat 96.55
PHA03095 471 ankyrin-like protein; Provisional 96.51
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 96.5
PHA02736154 Viral ankyrin protein; Provisional 96.43
PHA02878 477 ankyrin repeat protein; Provisional 96.39
PLN03192 823 Voltage-dependent potassium channel; Provisional 96.36
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 96.31
PHA02884 300 ankyrin repeat protein; Provisional 96.28
PHA02791 284 ankyrin-like protein; Provisional 96.23
PHA02946 446 ankyin-like protein; Provisional 96.23
PHA02795 437 ankyrin-like protein; Provisional 96.22
PHA03100 480 ankyrin repeat protein; Provisional 96.21
PHA02874 434 ankyrin repeat protein; Provisional 96.18
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 96.11
PHA02741169 hypothetical protein; Provisional 95.99
PHA02743166 Viral ankyrin protein; Provisional 95.97
PHA02859 209 ankyrin repeat protein; Provisional 95.94
PHA02884 300 ankyrin repeat protein; Provisional 95.89
PHA02741169 hypothetical protein; Provisional 95.8
KOG4412|consensus 226 95.8
PHA02730 672 ankyrin-like protein; Provisional 95.62
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 95.55
PHA02736154 Viral ankyrin protein; Provisional 95.53
PHA02798 489 ankyrin-like protein; Provisional 95.52
PHA02859209 ankyrin repeat protein; Provisional 95.49
PHA02876 682 ankyrin repeat protein; Provisional 95.48
KOG0509|consensus 600 95.47
COG0666 235 Arp FOG: Ankyrin repeat [General function predicti 95.44
PHA02946 446 ankyin-like protein; Provisional 95.37
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 95.35
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 95.22
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 95.12
PHA02989 494 ankyrin repeat protein; Provisional 95.02
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 94.85
PHA02876 682 ankyrin repeat protein; Provisional 94.81
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 94.74
PHA02791284 ankyrin-like protein; Provisional 94.59
PHA02917 661 ankyrin-like protein; Provisional 94.23
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 93.25
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 93.2
KOG0509|consensus 600 93.05
KOG4214|consensus117 92.76
KOG3676|consensus 782 92.63
KOG0502|consensus296 92.45
PHA02917 661 ankyrin-like protein; Provisional 92.25
KOG0505|consensus 527 92.15
KOG0510|consensus 929 91.85
PHA02792 631 ankyrin-like protein; Provisional 91.6
KOG1710|consensus 396 91.36
KOG0508|consensus615 91.14
KOG0512|consensus228 90.47
TIGR00870 743 trp transient-receptor-potential calcium channel p 90.41
PHA02792 631 ankyrin-like protein; Provisional 89.67
KOG4412|consensus226 88.64
PHA02795 437 ankyrin-like protein; Provisional 88.31
KOG0508|consensus 615 88.08
PHA02730 672 ankyrin-like protein; Provisional 87.2
KOG0515|consensus 752 86.61
KOG4177|consensus 1143 86.22
KOG0512|consensus 228 85.69
KOG2505|consensus 591 84.07
PF08332128 CaMKII_AD: Calcium/calmodulin dependent protein ki 83.82
KOG0502|consensus296 82.81
KOG0195|consensus 448 82.28
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information 
Probab=98.32  E-value=5.2e-07  Score=50.30  Aligned_cols=35  Identities=20%  Similarity=0.146  Sum_probs=28.1

Q ss_pred             HHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCccccc
Q psy15934         34 FLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVAL   69 (70)
Q Consensus        34 f~~aV~~~~~~kV~kLL~kGlDPN~~d~~~GeTpL~   69 (70)
                      ++.|+..|+.+-+.-|+++|.|||.+| +.|+|||+
T Consensus         5 lh~A~~~g~~~~~~~Ll~~~~din~~d-~~g~t~lh   39 (54)
T PF13637_consen    5 LHWAARSGNLEIVKLLLEHGADINAQD-EDGRTPLH   39 (54)
T ss_dssp             HHHHHHTT-HHHHHHHHHTTSGTT-B--TTS--HHH
T ss_pred             HHHHHHhCCHHHHHHHHHCCCCCCCCC-CCCCCHHH
Confidence            678999999999999999999999998 79999986

...
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
4gpm_A 169 Engineered protein OR264; de novo protein, structu 98.44
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 98.39
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 97.95
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 97.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 97.9
1bi7_B 156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 97.86
4gpm_A169 Engineered protein OR264; de novo protein, structu 97.84
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 97.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 97.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 97.76
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 97.73
2y1l_E 169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 97.72
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 97.71
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 97.69
1ihb_A 162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 97.66
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 97.6
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 97.58
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 97.58
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 97.57
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 97.57
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 97.56
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 97.55
2rfa_A 232 Transient receptor potential cation channel subfa 97.54
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 97.52
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 97.51
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 97.5
2rfa_A232 Transient receptor potential cation channel subfa 97.5
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 97.49
1sw6_A327 Regulatory protein SWI6; transcription regulation, 97.47
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 97.47
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 97.46
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 97.45
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 97.45
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 97.45
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 97.44
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 97.44
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 97.44
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 97.44
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 97.42
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 97.41
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 97.41
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 97.4
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 97.4
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 97.39
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 97.39
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 97.38
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 97.38
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 97.38
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 97.36
3v31_A167 Ankyrin repeat family A protein 2; structural geno 97.36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 97.36
1awc_B153 Protein (GA binding protein beta 1); complex (tran 97.35
3v31_A167 Ankyrin repeat family A protein 2; structural geno 97.34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 97.33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 97.33
3v30_A172 DNA-binding protein rfxank; structural genomics co 97.32
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 97.32
3hra_A 201 Ankyrin repeat family protein; structural protein; 97.32
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 97.31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 97.31
3v30_A172 DNA-binding protein rfxank; structural genomics co 97.3
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 97.3
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 97.29
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 97.28
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 97.28
3t8k_A 186 Uncharacterized protein; structural genomics, PSI- 97.28
1bd8_A 156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 97.26
2etb_A256 Transient receptor potential cation channel subfam 97.26
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 97.23
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 97.23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 97.23
3jxi_A260 Vanilloid receptor-related osmotically activated p 97.23
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 97.21
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 97.2
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 97.2
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 97.19
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 97.19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 97.18
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 97.18
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 97.18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 97.17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 97.17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 97.17
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 97.16
2pnn_A273 Transient receptor potential cation channel subfa 97.15
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 97.13
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 97.13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 97.12
3jxi_A 260 Vanilloid receptor-related osmotically activated p 97.12
3hra_A 201 Ankyrin repeat family protein; structural protein; 97.12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 97.11
2etb_A 256 Transient receptor potential cation channel subfam 97.1
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 97.1
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 97.08
2pnn_A 273 Transient receptor potential cation channel subfa 97.06
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 97.05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 97.03
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 97.02
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 96.97
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 96.87
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 96.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 96.82
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 96.77
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 96.74
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 96.71
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 96.69
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 96.62
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 96.52
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 96.51
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 96.42
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 96.37
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 96.25
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 91.38
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=98.44  E-value=1.7e-07  Score=60.84  Aligned_cols=37  Identities=24%  Similarity=0.350  Sum_probs=34.4

Q ss_pred             HHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCccccc
Q psy15934         32 KRFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVAL   69 (70)
Q Consensus        32 ~df~~aV~~~~~~kV~kLL~kGlDPN~~d~~~GeTpL~   69 (70)
                      +.++.|++.|+.+.|..||++|.|||..| ..|+|||+
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d-~~g~t~l~   42 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADVNASD-SDGRTPLH   42 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCTTCCC-TTSCCHHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCCCCcC-CCCCCHHH
Confidence            45899999999999999999999999999 59999986
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 98.4
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 98.34
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1ihba_ 156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.14
d1wdya_ 285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 98.11
d1bd8a_ 156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 98.01
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 97.99
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 97.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 97.91
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 97.78
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 97.72
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 97.71
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 97.69
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 97.68
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 97.65
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 97.64
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 97.63
d1awcb_ 153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 97.56
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 97.43
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 97.43
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 97.41
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 97.37
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 97.35
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 97.26
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 97.23
d1dcqa1 154 Pyk2-associated protein beta {Mouse (Mus musculus) 97.21
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 97.14
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 97.1
d1ixva_ 229 26S proteasome non-ATPase regulatory subunit 10, g 97.0
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 96.9
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 96.74
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 96.58
d1iknd_ 221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 96.33
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 94.94
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 93.16
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=98.40  E-value=1.5e-07  Score=56.23  Aligned_cols=36  Identities=25%  Similarity=0.322  Sum_probs=34.0

Q ss_pred             HHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCccccc
Q psy15934         33 RFLEYVNNSQVEKIAKLCAKGLDPNFHCPETGEMVAL   69 (70)
Q Consensus        33 df~~aV~~~~~~kV~kLL~kGlDPN~~d~~~GeTpL~   69 (70)
                      -||.|++.|+.+.|..|+++|.|||..| ..|.|||+
T Consensus         5 pL~~A~~~g~~~~v~~Ll~~g~d~n~~~-~~g~t~lh   40 (118)
T d1myoa_           5 EFMWALKNGDLDEVKDYVAKGEDVNRTL-EGGRKPLH   40 (118)
T ss_dssp             HHHHHHHTTCHHHHHHHHTTTCCCCCCS-SSSCCTTH
T ss_pred             HHHHHHHCCCHHHHHHHHHhhhcccccc-cccccccc
Confidence            5899999999999999999999999999 59999996
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure