Diaphorina citri psyllid: psy15935


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MNSRGDYFPILGICLGFELLLFVENKEKELRTDCNCFHENLSLRFLKNGSKTGLYKTFPKKSLKALAKNNITYNYHIWCITRATMNSTKLSDAWDILTESKAGNGKKFVSTVQSKKYPFVGIQFHPEKNSYEWNTVAHVNHSRIAIETSRLFYDWIVTEASKNKHAYPSHADLYKEVIYNYAPTMSYPLNNKTSFEQIYFFD
ccccccEEcEEEEHHHHHHHHHHHcccEEECccccccccCEEEEEECccccccccccccHHHHHHHHcccEEEEEEEEEEEEcccccccccccEEEEEEECcccccEEEEEEEcccccEEEEECccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccCEECcccccccccEEEEEcc
MNSRGDYFPILGICLGFELLLFVENKEKELRTDCNCFHENLSLRFLKNGSKTGLYKTFPKKSLKALAKNNITYNYHIWCITRATMNSTKLSDAWDILTESKAGNGKKFVSTVQSKKYPFVGIQFHPEKNSYEWNTVAHVNHSRIAIETSRLFYDWIVTEASKNKHAYPSHADLYKEVIYNYAPTMSYPLNNKTSFEQIYFFD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSRGDYFPILGICLGFELLLFVENKEKELRTDCNCFHENLSLRFLKNGSKTGLYKTFPKKSLKALAKNNITYNYHIWCITRATMNSTKLSDAWDILTESKAGNGKKFVSTVQSKKYPFVGIQFHPEKNSYEWNTVAHVNHSRIAIETSRLFYDWIVTEASKNKHAYPSHADLYKEVIYNYAPTMSYPLNNKTSFEQIYFFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gamma-glutamyl hydrolase Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates. Exhibits either endo- or exopeptidase activity depending upon the tissue of origin. When secreted, it acts primarily as an endopeptidase.confidentQ62867
Gamma-glutamyl hydrolase Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates.confidentQ92820
Gamma-glutamyl hydrolase Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates. Acts as endopeptidase. Lysosomal enzyme is activated by sulfhydryl compounds.confidentQ9Z0L8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010043 [BP]response to zinc ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006760 [BP]folic acid-containing compound metabolic processprobableGO:0006732, GO:0019752, GO:0006807, GO:0044281, GO:1901360, GO:0044710, GO:0051186, GO:0006520, GO:0042558, GO:0071704, GO:1901605, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:0044237
GO:0034722 [MF]gamma-glutamyl-peptidase activityprobableGO:0016787, GO:0003824, GO:0008242, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032868 [BP]response to insulin stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0043434, GO:0010033
GO:0045471 [BP]response to ethanolprobableGO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L9X, chain A
Confidence level:very confident
Coverage over the Query: 4-202
View the alignment between query and template
View the model in PyMOL