Diaphorina citri psyllid: psy15938


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MSFAPVKTTSSTLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVAQKYKVP
ccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccHHHHHHHHHcHHcccccccccccEEEEEEEccEEEEEEEECcccEEEEEEEEEEECcccEEEEEECcccccccEEEEEEEECcccccccCEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc
***********TLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVA******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFAPVKTTSSTLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVAQKYKVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coenzyme Q-binding protein COQ10, mitochondrial Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes.confidentQ8MLL3
Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes.confidentQ567E6
Coenzyme Q-binding protein COQ10 homolog B, mitochondrial Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes.confidentQ9H8M1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T17, chain A
Confidence level:very confident
Coverage over the Query: 44-190
View the alignment between query and template
View the model in PyMOL