Psyllid ID: psy15938


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MSFAPVKTTSSTLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVAQKYKVP
ccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccHHHHHHHHHcHHcccccccccccEEEEEEEccEEEEEEEEEcccEEEEEEEEEEEEcccEEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccc
ccccHHHHHHHHHccccccccccccccccccccEEcccccccccEEEEEEEEEcccHHHHHHHHHHHHHcccHcccccccEEEEcccccEEEEEEEccccEEEEEEEEEEEccccEEEEEEcccccHHHcccEEEEccccccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccc
msfapvkttsstllkkcipsynaipliytqqksFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIigsltigfppivesytsnvtldrpklikancfdgklFDHLVTMWRFhrgledvpqscviDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEmrygkptipihrlpvnvaqkykvp
msfapvkttsstllkkcIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEkkiigsltigfppiVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKptipihrlpvnvaqkykvp
MSFAPVKTTSSTLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVAQKYKVP
***********TLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVA******
*************************L*YTQQKSFF**************RKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPT*****************
***********TLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVAQKYKVP
*SFAPVKTTSSTLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVA******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFAPVKTTSSTLLKKCIPSYNAIPLIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAEAEMRYGKPTIPIHRLPVNVAQKYKVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q567E6238 Coenzyme Q-binding protei yes N/A 0.789 0.693 0.426 6e-35
Q9H8M1238 Coenzyme Q-binding protei yes N/A 0.808 0.710 0.424 4e-33
Q5RD79238 Coenzyme Q-binding protei yes N/A 0.808 0.710 0.424 4e-33
Q8MLL3242 Coenzyme Q-binding protei yes N/A 0.889 0.768 0.395 1e-32
Q6DFA6247 Coenzyme Q-binding protei N/A N/A 0.751 0.635 0.438 1e-31
Q3THF9240 Coenzyme Q-binding protei yes N/A 0.765 0.666 0.418 2e-31
Q5I0I9240 Coenzyme Q-binding protei yes N/A 0.674 0.587 0.457 2e-31
Q96MF6247 Coenzyme Q-binding protei no N/A 0.674 0.570 0.431 8e-31
Q6GNP0244 Coenzyme Q-binding protei N/A N/A 0.751 0.643 0.362 3e-27
Q6PBN4233 Coenzyme Q-binding protei no N/A 0.574 0.515 0.463 1e-24
>sp|Q567E6|CQ10B_DANRE Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Danio rerio GN=coq10b PE=2 SV=1 Back     alignment and function desciption
 Score =  147 bits (371), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 111/178 (62%), Gaps = 13/178 (7%)

Query: 8   TTSSTLLKKCIPSYNAIP--LIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVS 65
           ++   L+ +  P + A+    +    +SFFN A++ +K+KEY  R+++GYS ++MYEVV+
Sbjct: 37  SSCGILMTRAPPLFRAVSSRAVVAPARSFFNFAESSNKRKEYSERRIIGYSMQEMYEVVA 96

Query: 66  DVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGK 125
            VE+Y  FVP+CKKS V ++        LT+GFPP+VE+YTS V+  RP L+KA+C DGK
Sbjct: 97  KVEDYLLFVPWCKKSDVIFRRSGFCKAKLTVGFPPVVENYTSLVSTVRPHLVKASCSDGK 156

Query: 126 LFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSMQMEKAFFAE 183
           LF+HL T+WRF  GL   P++C +DF +   F          R LL S Q+   FF E
Sbjct: 157 LFNHLETVWRFSPGLPGYPRTCTLDFAISFEF----------RSLLHS-QLATVFFDE 203




Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes.
Danio rerio (taxid: 7955)
>sp|Q9H8M1|CQ10B_HUMAN Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Homo sapiens GN=COQ10B PE=2 SV=1 Back     alignment and function description
>sp|Q5RD79|CQ10B_PONAB Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Pongo abelii GN=COQ10B PE=2 SV=1 Back     alignment and function description
>sp|Q8MLL3|COQ10_DROME Coenzyme Q-binding protein COQ10, mitochondrial OS=Drosophila melanogaster GN=Coq10 PE=2 SV=1 Back     alignment and function description
>sp|Q6DFA6|CQ10A_XENLA Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Xenopus laevis GN=coq10b-a PE=2 SV=1 Back     alignment and function description
>sp|Q3THF9|CQ10B_MOUSE Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Mus musculus GN=Coq10b PE=2 SV=1 Back     alignment and function description
>sp|Q5I0I9|CQ10B_RAT Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Rattus norvegicus GN=Coq10b PE=2 SV=2 Back     alignment and function description
>sp|Q96MF6|CQ10A_HUMAN Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Homo sapiens GN=COQ10A PE=2 SV=2 Back     alignment and function description
>sp|Q6GNP0|CQ10B_XENLA Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Xenopus laevis GN=coq10b PE=2 SV=1 Back     alignment and function description
>sp|Q6PBN4|CQ10X_DANRE Coenzyme Q-binding protein COQ10 homolog, mitochondrial OS=Danio rerio GN=zgc:73324 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
157136481199 hypothetical protein AaeL_AAEL003452 [Ae 0.851 0.894 0.480 1e-40
383865285164 PREDICTED: coenzyme Q-binding protein CO 0.746 0.951 0.541 3e-40
158285748204 AGAP007391-PA [Anopheles gambiae str. PE 0.961 0.985 0.435 3e-40
242004772216 protein COQ10, putative [Pediculus human 0.760 0.736 0.512 7e-40
340712073202 PREDICTED: coenzyme Q-binding protein CO 0.760 0.787 0.525 9e-40
350398735162 PREDICTED: coenzyme Q-binding protein CO 0.751 0.969 0.531 1e-39
357609455220 hypothetical protein KGM_08229 [Danaus p 0.779 0.740 0.503 8e-39
170048831189 conserved hypothetical protein [Culex qu 0.851 0.941 0.463 1e-38
322794414189 hypothetical protein SINV_14238 [Solenop 0.746 0.825 0.522 2e-38
328783983164 PREDICTED: coenzyme Q-binding protein CO 0.732 0.932 0.518 3e-38
>gi|157136481|ref|XP_001656848.1| hypothetical protein AaeL_AAEL003452 [Aedes aegypti] gi|108881017|gb|EAT45242.1| AAEL003452-PB [Aedes aegypti] Back     alignment and taxonomy information
 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 114/179 (63%), Gaps = 1/179 (0%)

Query: 26  LIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYK 85
           L+Y+  +  F+     + ++E+  +KL GYS EQ+Y+VVSDVE Y  FVPFCKKS V  K
Sbjct: 21  LLYSTYRGLFDFTPITNTRREFKQKKLAGYSMEQLYDVVSDVEKYNTFVPFCKKSHVYAK 80

Query: 86  SEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQ 145
               +   L IGFPP+ ESYTSNVTL RP L+KA C DG+LF++L+T W+F  GL+D+PQ
Sbjct: 81  KPGSLKADLIIGFPPLNESYTSNVTLVRPSLVKAECVDGRLFNYLLTAWQFSPGLKDIPQ 140

Query: 146 SCVIDFYMEKAFFAEAEMRYGNRVLLTSM-QMEKAFFAEAEMRYGKPTIPIHRLPVNVA 203
           SCVIDF +   F +    +  N      + QME AF  EA  RYG+P+I  H L  N +
Sbjct: 141 SCVIDFMVAFEFKSALHSQLSNLFFDQLVKQMEYAFIQEAGHRYGRPSIKSHVLVSNTS 199




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383865285|ref|XP_003708105.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog B, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|158285748|ref|XP_308441.4| AGAP007391-PA [Anopheles gambiae str. PEST] gi|157020142|gb|EAA04466.4| AGAP007391-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|242004772|ref|XP_002423252.1| protein COQ10, putative [Pediculus humanus corporis] gi|212506238|gb|EEB10514.1| protein COQ10, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340712073|ref|XP_003394589.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog B, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350398735|ref|XP_003485293.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog B, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|357609455|gb|EHJ66458.1| hypothetical protein KGM_08229 [Danaus plexippus] Back     alignment and taxonomy information
>gi|170048831|ref|XP_001870796.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167870795|gb|EDS34178.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|322794414|gb|EFZ17503.1| hypothetical protein SINV_14238 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|328783983|ref|XP_001120956.2| PREDICTED: coenzyme Q-binding protein COQ10 homolog B, mitochondrial-like [Apis mellifera] gi|380029970|ref|XP_003698636.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog B, mitochondrial-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
ZFIN|ZDB-GENE-050417-263238 coq10b "coenzyme Q10 homolog B 0.866 0.760 0.422 1.7e-34
UNIPROTKB|F1MK72244 COQ10B "Uncharacterized protei 0.856 0.733 0.409 4.7e-32
UNIPROTKB|Q9H8M1238 COQ10B "Coenzyme Q-binding pro 0.870 0.764 0.421 1.3e-31
UNIPROTKB|B7Z1Y4195 COQ10B "cDNA FLJ52258, highly 0.866 0.928 0.418 3.3e-31
UNIPROTKB|F1SMZ8246 COQ10B "Uncharacterized protei 0.861 0.731 0.417 1.4e-30
RGD|1359509240 Coq10b "coenzyme Q10 homolog B 0.779 0.679 0.433 1.8e-30
MGI|MGI:1915126240 Coq10b "coenzyme Q10 homolog B 0.870 0.758 0.4 3e-30
UNIPROTKB|Q96MF6247 COQ10A "Coenzyme Q-binding pro 0.602 0.510 0.456 2.7e-29
ZFIN|ZDB-GENE-040426-1760233 zgc:73324 "zgc:73324" [Danio r 0.746 0.669 0.406 5.9e-25
TAIR|locus:2129321256 AT4G17650 "AT4G17650" [Arabido 0.531 0.433 0.403 7.5e-18
ZFIN|ZDB-GENE-050417-263 coq10b "coenzyme Q10 homolog B (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 374 (136.7 bits), Expect = 1.7e-34, P = 1.7e-34
 Identities = 79/187 (42%), Positives = 114/187 (60%)

Query:    13 LLKKCIPSYNAIP--LIYTQQKSFFNIADTFSKKKEYLGRKLVGYSREQMYEVVSDVENY 70
             L+ +  P + A+    +    +SFFN A++ +K+KEY  R+++GYS ++MYEVV+ VE+Y
Sbjct:    42 LMTRAPPLFRAVSSRAVVAPARSFFNFAESSNKRKEYSERRIIGYSMQEMYEVVAKVEDY 101

Query:    71 KNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPKLIKANCFDGKLFDHL 130
               FVP+CKKS V ++        LT+GFPP+VE+YTS V+  RP L+KA+C DGKLF+HL
Sbjct:   102 LLFVPWCKKSDVIFRRSGFCKAKLTVGFPPVVENYTSLVSTVRPHLVKASCSDGKLFNHL 161

Query:   131 VTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRVLLTSM--QMEKAFFAEAEMRY 188
              T+WRF  GL   P++C +DF +   F +    +    V    +  QM  AF   A   Y
Sbjct:   162 ETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLAT-VFFDEVVKQMVSAFERRASKLY 220

Query:   189 GKPT-IP 194
             G  T IP
Sbjct:   221 GPETQIP 227




GO:0016020 "membrane" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0005743 "mitochondrial inner membrane" evidence=IEA
UNIPROTKB|F1MK72 COQ10B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H8M1 COQ10B "Coenzyme Q-binding protein COQ10 homolog B, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z1Y4 COQ10B "cDNA FLJ52258, highly similar to Protein COQ10 B, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMZ8 COQ10B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1359509 Coq10b "coenzyme Q10 homolog B (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1915126 Coq10b "coenzyme Q10 homolog B (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96MF6 COQ10A "Coenzyme Q-binding protein COQ10 homolog A, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1760 zgc:73324 "zgc:73324" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2129321 AT4G17650 "AT4G17650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8MLL3COQ10_DROMENo assigned EC number0.39570.88990.7685yesN/A
Q567E6CQ10B_DANRENo assigned EC number0.42690.78940.6932yesN/A
Q5RD79CQ10B_PONABNo assigned EC number0.42470.80860.7100yesN/A
Q3THF9CQ10B_MOUSENo assigned EC number0.41860.76550.6666yesN/A
Q9H8M1CQ10B_HUMANNo assigned EC number0.42470.80860.7100yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
cd07813138 cd07813, COQ10p_like, Coenzyme Q-binding protein C 5e-39
COG2867146 COG2867, COG2867, Oligoketide cyclase/lipid transp 1e-19
pfam03364125 pfam03364, Polyketide_cyc, Polyketide cyclase / de 4e-16
PRK10724158 PRK10724, PRK10724, hypothetical protein; Provisio 6e-11
>gnl|CDD|176855 cd07813, COQ10p_like, Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
 Score =  130 bits (330), Expect = 5e-39
 Identities = 53/145 (36%), Positives = 77/145 (53%), Gaps = 21/145 (14%)

Query: 50  RKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNV 109
            +LV YS EQM+++V+DVE Y  F+P+C  S V  + E ++   LT+GF  I ES+TS V
Sbjct: 4   SRLVPYSAEQMFDLVADVERYPEFLPWCTASRVLERDEDELEAELTVGFGGIRESFTSRV 63

Query: 110 TLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAEAEMRYGNRV 169
           TL  P+ I+A   DG  F HL   WRF    E+   +C ++F +E  F         +R+
Sbjct: 64  TLVPPESIEAELVDG-PFKHLEGEWRFKPLGEN---ACKVEFDLEFEF--------KSRL 111

Query: 170 L--LTSM-------QMEKAFFAEAE 185
           L  L  +       +M  AF   A+
Sbjct: 112 LEALAGLVFDEVAKKMVDAFEKRAK 136


Coenzyme Q-binding protein COQ10p and similar proteins. COQ10p is a hydrophobic protein located in the inner membrane of mitochondria that binds coenzyme Q (CoQ), also called ubiquinone, which is an essential electron carrier of the respiratory chain. Deletion of the gene encoding COQ10p (COQ10 or YOL008W) in Saccharomyces cerevisiae results in respiratory defect because of the inability to oxidize NADH and succinate. COQ10p may function in the delivery of CoQ (Q6 in budding yeast) to its proper location for electron transport. The human homolog, called Q-binding protein COQ10 homolog A (COQ10A), is able to fully complement for the absence of COQ10p in fission yeast. Human COQ10A also has a splice variant COQ10B. COQ10p belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. Length = 138

>gnl|CDD|225422 COG2867, COG2867, Oligoketide cyclase/lipid transport protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|217515 pfam03364, Polyketide_cyc, Polyketide cyclase / dehydrase and lipid transport Back     alignment and domain information
>gnl|CDD|182678 PRK10724, PRK10724, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
COG2867146 Oligoketide cyclase/lipid transport protein [Lipid 100.0
PRK10724158 hypothetical protein; Provisional 100.0
KOG3177|consensus227 100.0
cd07813138 COQ10p_like Coenzyme Q-binding protein COQ10p and 99.96
cd08860146 TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom 99.93
PF03364130 Polyketide_cyc: Polyketide cyclase / dehydrase and 99.91
cd08866144 SRPBCC_11 Ligand-binding SRPBCC domain of an uncha 99.88
cd08861142 OtcD1_ARO-CYC_like N-terminal and C-terminal aroma 99.87
cd07819140 SRPBCC_2 Ligand-binding SRPBCC domain of an unchar 99.86
cd07817139 SRPBCC_8 Ligand-binding SRPBCC domain of an unchar 99.76
cd05018144 CoxG Carbon monoxide dehydrogenase subunit G (CoxG 99.75
cd08865140 SRPBCC_10 Ligand-binding SRPBCC domain of an uncha 99.7
cd07818150 SRPBCC_1 Ligand-binding SRPBCC domain of an unchar 99.69
cd07824146 SRPBCC_6 Ligand-binding SRPBCC domain of an unchar 99.69
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 99.68
cd07821140 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), 99.64
PF10604139 Polyketide_cyc2: Polyketide cyclase / dehydrase an 99.6
cd07820137 SRPBCC_3 Ligand-binding SRPBCC domain of an unchar 99.57
cd07823146 SRPBCC_5 Ligand-binding SRPBCC domain of an unchar 99.53
cd08862138 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of 99.48
cd07812141 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR 99.47
cd07822141 SRPBCC_4 Ligand-binding SRPBCC domain of an unchar 99.4
cd07814139 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- 99.34
COG5637217 Predicted integral membrane protein [Function unkn 99.19
PF06240140 COXG: Carbon monoxide dehydrogenase subunit G (Cox 99.15
cd07825144 SRPBCC_7 Ligand-binding SRPBCC domain of an unchar 99.11
cd07816148 Bet_v1-like Ligand-binding bet_v_1 domain of major 98.96
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 98.91
cd08906209 START_STARD3-like Cholesterol-binding START domain 98.86
COG3427146 Carbon monoxide dehydrogenase subunit G, CoxG [Ene 98.84
cd08905209 START_STARD1-like Cholesterol-binding START domain 98.83
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 98.68
cd08874205 START_STARD9-like C-terminal START domain of mamma 98.63
cd08873235 START_STARD14_15-like Lipid-binding START domain o 98.62
cd08870209 START_STARD2_7-like Lipid-binding START domain of 98.62
cd08871222 START_STARD10-like Lipid-binding START domain of m 98.57
cd08911207 START_STARD7-like Lipid-binding START domain of ma 98.55
cd00177193 START Lipid-binding START domain of mammalian STAR 98.53
cd08893136 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobi 98.49
cd08914236 START_STARD15-like Lipid-binding START domain of m 98.45
cd08913240 START_STARD14-like Lipid-binding START domain of m 98.42
cd08899157 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligan 98.38
cd08903208 START_STARD5-like Lipid-binding START domain of ma 98.37
smart00234206 START in StAR and phosphatidylcholine transfer pro 98.33
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 98.21
cd08867206 START_STARD4_5_6-like Lipid-binding START domain o 98.18
cd08908204 START_STARD12-like C-terminal lipid-binding START 98.17
cd08898145 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligan 98.16
cd08910207 START_STARD2-like Lipid-binding START domain of ma 98.14
cd08872235 START_STARD11-like Ceramide-binding START domain o 98.09
cd08894139 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligan 98.06
cd08900143 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligan 97.98
PF01852206 START: START domain; InterPro: IPR002913 START (St 97.96
cd08897133 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligan 97.88
cd08896146 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligan 97.84
PF00407151 Bet_v_1: Pathogenesis-related protein Bet v I fami 97.84
cd08895146 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligan 97.77
cd07826142 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligan 97.63
PF08327124 AHSA1: Activator of Hsp90 ATPase homolog 1-like pr 97.57
cd08909205 START_STARD13-like C-terminal lipid-binding START 97.39
cd08901136 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligan 97.27
cd08891149 SRPBCC_CalC Ligand-binding SRPBCC domain of Microm 97.23
cd08904204 START_STARD6-like Lipid-binding START domain of ma 97.15
PF10698159 DUF2505: Protein of unknown function (DUF2505); In 96.78
cd08892126 SRPBCC_Aha1 Putative hydrophobic ligand-binding SR 96.61
PF08982149 DUF1857: Domain of unknown function (DUF1857); Int 96.51
COG3832149 Uncharacterized conserved protein [Function unknow 96.4
COG4276153 Uncharacterized conserved protein [Function unknow 95.93
cd08863141 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand- 95.87
PTZ00220132 Activator of HSP-90 ATPase; Provisional 95.5
cd08902202 START_STARD4-like Lipid-binding START domain of ma 95.32
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 87.26
>COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] Back     alignment and domain information
Probab=100.00  E-value=3.2e-40  Score=260.30  Aligned_cols=143  Identities=31%  Similarity=0.536  Sum_probs=131.7

Q ss_pred             ceEEEEEEEEcCCHHHHHHHHhchhcccccCCCcceEEEEEecCCeEEEEEEEeeCCceeEEEEEEEecCCC-eEEEEee
Q psy15938         44 KKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNVTLDRPK-LIKANCF  122 (209)
Q Consensus        44 ~~~~~~~~~I~~~~~~vf~vV~DVe~YpeFlP~c~~s~Vle~~~~~~~a~l~v~~~~~~~~~tsrv~~~~~~-~I~~~~~  122 (209)
                      |+++..+++++|+|++||++|+||++||+|+|||.+++|+++++..+.|+++|+++++.++|+++|++.++. .|.+.+.
T Consensus         1 m~~~~~s~lv~y~a~~mF~LV~dV~~YP~FlP~C~~s~v~~~~~~~l~A~l~V~~k~i~e~F~Trv~~~~~~~~I~~~l~   80 (146)
T COG2867           1 MPQIERTALVPYSASQMFDLVNDVESYPEFLPWCSASRVLERNERELIAELDVGFKGIRETFTTRVTLKPTARSIDMKLI   80 (146)
T ss_pred             CCeeEeeeeccCCHHHHHHHHHHHHhCchhccccccceEeccCcceeEEEEEEEhhheeeeeeeeeeecCchhhhhhhhh
Confidence            678999999999999999999999999999999999999999999999999999999999999999999976 8999999


Q ss_pred             cCcccceeeeEEEEEeCCCCCCCceEEEEEEEEEeCcc-hhhhhcchhhhhHHHHHHHHHHHHHHHhCC
Q psy15938        123 DGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAE-AEMRYGNRVLLTSMQMEKAFFAEAEMRYGK  190 (209)
Q Consensus       123 ~G~~F~~l~g~W~f~p~~~~~~~~T~V~f~l~fef~~p-~~~~~~~~~~~~~~~ml~af~~RA~~ly~~  190 (209)
                      +| ||+.|.|.|+|.|+++   ++|+|+|.|+|||+|+ .++++..+.+.++++|++||++||+++||.
T Consensus        81 ~G-PFk~L~~~W~F~pl~~---~~ckV~f~ldfeF~s~ll~~~~g~~f~~~a~~mv~aF~kRA~~~y~~  145 (146)
T COG2867          81 DG-PFKYLKGGWQFTPLSE---DACKVEFFLDFEFKSRLLGALIGPVFKRLASKMVEAFEKRAKEVYGL  145 (146)
T ss_pred             cC-ChhhhcCceEEEECCC---CceEEEEEEEeeehhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcC
Confidence            99 7999999999999875   7999999999999999 444444444444999999999999999985



>PRK10724 hypothetical protein; Provisional Back     alignment and domain information
>KOG3177|consensus Back     alignment and domain information
>cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
>cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains Back     alignment and domain information
>PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp Back     alignment and domain information
>cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains Back     alignment and domain information
>cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information
>PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis Back     alignment and domain information
>cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu Back     alignment and domain information
>cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily Back     alignment and domain information
>cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins Back     alignment and domain information
>COG5637 Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster Back     alignment and domain information
>cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] Back     alignment and domain information
>cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>cd08893 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins; some contain an N-terminal GntR family winged HTH DNA-binding domain Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins Back     alignment and domain information
>cd08899 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins Back     alignment and domain information
>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08898 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins Back     alignment and domain information
>cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains Back     alignment and domain information
>cd08894 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08900 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] Back     alignment and domain information
>cd08897 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08896 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>PF00407 Bet_v_1: Pathogenesis-related protein Bet v I family; InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms Back     alignment and domain information
>cd08895 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd07826 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>PF08327 AHSA1: Activator of Hsp90 ATPase homolog 1-like protein; InterPro: IPR013538 This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90 kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433 from SWISSPROT) Back     alignment and domain information
>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08901 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08891 SRPBCC_CalC Ligand-binding SRPBCC domain of Micromonospora echinospora CalC and related proteins Back     alignment and domain information
>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins Back     alignment and domain information
>PF10698 DUF2505: Protein of unknown function (DUF2505); InterPro: IPR019639 This entry represents proteins found Actinobacteria and Proteobacteria Back     alignment and domain information
>cd08892 SRPBCC_Aha1 Putative hydrophobic ligand-binding SRPBCC domain of the Hsp90 co-chaperone Aha1 and related proteins Back     alignment and domain information
>PF08982 DUF1857: Domain of unknown function (DUF1857); InterPro: IPR015075 This protein has no known function Back     alignment and domain information
>COG3832 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd08863 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily Back     alignment and domain information
>PTZ00220 Activator of HSP-90 ATPase; Provisional Back     alignment and domain information
>cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
2d4r_A147 Hypothetical protein TTHA0849; start domain, struc 7e-21
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BE 7e-21
3tfz_A172 Cyclase; helix-GRIP, BET V1-like superfamily, bios 6e-16
3tl1_A159 WHIE ORF VI, polyketide cyclase; helix-GRIP fold, 2e-12
3tvq_A169 Multifunctional cyclase-dehydratase-3-O-methyl TR 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Length = 147 Back     alignment and structure
 Score = 83.7 bits (207), Expect = 7e-21
 Identities = 12/106 (11%), Positives = 29/106 (27%), Gaps = 6/106 (5%)

Query: 50  RKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKKIIGSLTIGFPPIVESYTSNV 109
            + +    E++Y +  D+E  K ++   +   V  +   +               +    
Sbjct: 7   ERYIPAPPERVYRLAKDLEGLKPYLKEVESLEVVAREGARTRSRWVAVAMGKKVRWLEEE 66

Query: 110 TLDRPK-LIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYME 154
             D      +    +G  FD     W F        +   +   + 
Sbjct: 67  EWDDENLRNRFFSPEG-DFDRYEGTWVF----LPEGEGTRVVLTLT 107


>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 Length = 148 Back     alignment and structure
>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Length = 172 Back     alignment and structure
>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Length = 159 Back     alignment and structure
>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Length = 169 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BE 100.0
3tfz_A172 Cyclase; helix-GRIP, BET V1-like superfamily, bios 99.96
3tl1_A159 WHIE ORF VI, polyketide cyclase; helix-GRIP fold, 99.96
3p9v_A161 Uncharacterized protein; structural genomics, PSI- 99.94
3tvq_A169 Multifunctional cyclase-dehydratase-3-O-methyl TR 99.94
2d4r_A147 Hypothetical protein TTHA0849; start domain, struc 99.91
3ggn_A155 Uncharacterized protein DR_A0006; structural genom 99.87
2pcs_A162 Conserved protein; structural genomics, unknown fu 99.76
2ns9_A157 Hypothetical protein APE2225; uncharacterized cons 99.75
3qsz_A189 STAR-related lipid transfer protein; structural ge 99.68
2le1_A151 Uncharacterized protein; structural genomics, nort 99.63
3f08_A146 Uncharacterized protein Q6HG14; NESG Q6HG14_bachk 99.54
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 99.43
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 99.43
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 99.41
3p51_A160 Uncharacterized protein; structural genomics, PSI- 99.41
3ijt_A155 SMU.440, putative uncharacterized protein; hypothe 99.36
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 99.35
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 99.32
2qpv_A156 Uncharacterized protein ATU1531; structural genomi 99.19
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 99.15
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 99.06
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pat 99.03
4a8u_A159 Major pollen allergen BET V 1-J; PR-10 protein; 1. 99.01
3rws_A168 MTN13 protein; zeatin, cytokinin, hormone, lucerne 98.96
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, li 98.94
3rt2_A183 Abscisic acid receptor PYL10; ABA-independent PP2C 98.93
3oqu_A205 Abscisic acid receptor PYL9; RCAR1, hormone recept 98.81
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 98.77
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hyperic 98.76
3jrs_A208 PYL1, putative uncharacterized protein AT5G46790; 98.75
1z94_A147 Conserved hypothetical protein; NESG, CV1439, stru 98.75
3k3k_A211 Abscisic acid receptor PYR1; ABA receptor, plant h 98.7
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 98.65
1xfs_A178 NC_840354, conserved hypothetical protein; structu 98.56
2leq_A146 Uncharacterized protein; start domains, structural 98.56
1xuv_A178 Hypothetical protein MM0500; alpha-beta protein, n 98.51
2wql_A154 Major allergen DAU C 1; pathogenesis-related prote 98.51
2lak_A160 AHSA1-like protein RHE_CH02687; NESG, structural g 98.47
2lgh_A144 Uncharacterized protein; AHSA1, start domain, COG3 98.47
2lcg_A142 Uncharacterized protein; start domain, structural 98.46
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 98.43
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 98.42
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 98.41
1vjh_A122 BET V I allergen family; structural genomics, cent 98.41
3put_A166 Hypothetical conserved protein; structural genomic 98.41
2l8o_A144 Uncharacterized protein; mixed alpha-beta protein, 98.41
2il5_A171 Hypothetical protein; structural genomics, APC2365 98.37
3pu2_A164 Uncharacterized protein; SRPBCC superfamily, PSI-b 98.37
3q64_A162 MLL3774 protein; structural genomics, PSI-biology, 98.36
2ldk_A172 Uncharacterized protein; structural genomics, nort 98.35
3rd6_A161 MLL3558 protein; structural genomics, PSI-biology, 98.34
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 98.33
1xn5_A146 BH1534 unknown conserved protein; structural genom 98.28
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.28
3qrz_A223 Abscisic acid receptor PYL5; crystal, hormone rece 98.27
1xn6_A143 Hypothetical protein BC4709; structural genomics, 98.25
2lf2_A175 Uncharacterized protein; NESG, structural genomics 98.24
3q6a_A135 Uncharacterized protein; structural genomics, PSI- 98.22
2nn5_A184 Hypothetical protein EF_2215; structural genomics, 98.21
3eli_A152 AHSA1, AHA1 domain protein; alpha-beta protein, st 98.19
2l9p_A164 Uncharacterized protein; structural genomics, nort 98.15
2k5g_A191 Uncharacterized protein; structural genomiccs, pro 98.09
2pso_A237 STAR-related lipid transfer protein 13; alpha and 98.08
3oji_A189 Abscisic acid receptor PYL3; crystal, PP2C, pyraba 98.07
3q63_A151 MLL2253 protein; structural genomics, PSI-biology, 98.02
2kew_A152 Uncharacterized protein YNDB; start domain, resona 97.9
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 97.85
3uid_A168 Putative uncharacterized protein; SRPBCC superfami 97.8
4fpw_A181 CALU16; structural genomics, PSI-biology, northeas 97.54
2luz_A192 CALU16; structural genomics, northeast structural 97.39
1x53_A145 Activator of 90 kDa heat shock protein ATPase homo 97.37
3ni8_A158 PFC0360W protein; heat shock, malaria, ATPase, str 97.2
1zxf_A155 CALC; SELF-sacrificing resistance protein, structu 97.16
2ffs_A157 Hypothetical protein PA1206; 7-stranded beta sheet 96.62
2lio_A136 Uncharacterized protein; structural genomics, nort 92.38
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 Back     alignment and structure
Probab=100.00  E-value=7.6e-34  Score=222.36  Aligned_cols=142  Identities=23%  Similarity=0.352  Sum_probs=131.7

Q ss_pred             ceEEEEEEEEcCCHHHHHHHHhchhcccccCCCcceEEEEEecC----CeEEEEEEEeeCCceeEEEEEEEecCCC-eEE
Q psy15938         44 KKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSE----KKIIGSLTIGFPPIVESYTSNVTLDRPK-LIK  118 (209)
Q Consensus        44 ~~~~~~~~~I~~~~~~vf~vV~DVe~YpeFlP~c~~s~Vle~~~----~~~~a~l~v~~~~~~~~~tsrv~~~~~~-~I~  118 (209)
                      |.+++.++.|++|+++||++|+|+++||+|+|+|.+++++++++    +...++++++++++.++|++++++++++ +|.
T Consensus         1 M~~~~~s~~i~ap~~~v~~~v~D~~~~p~~~p~~~~~~v~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~i~   80 (148)
T 1t17_A            1 MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFSFLREKFATRVRRDKDARSID   80 (148)
T ss_dssp             CCEEEEEEEESSCTHHHHHHHTTTTCCSSCCSSCCCCCEEEEEEETTEEEEEEEEECSTTSSCCEEEEEEEEETTTCEEE
T ss_pred             CCEEEEEEEecCCHHHHHHHHHHHhhHHhhCCCcCeeEEEEecCCCCCceEEEEEEEEecceeEEEEEEEEEcCCCcEEE
Confidence            67899999999999999999999999999999999999999766    6799999999999999999999999987 999


Q ss_pred             EEeecCcccceeeeEEEEEeCCCCCCCceEEEEEEEEEeCcc-hhhhhcchhhhhHHHHHHHHHHHHHHHhCC
Q psy15938        119 ANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAE-AEMRYGNRVLLTSMQMEKAFFAEAEMRYGK  190 (209)
Q Consensus       119 ~~~~~G~~F~~l~g~W~f~p~~~~~~~~T~V~f~l~fef~~p-~~~~~~~~~~~~~~~ml~af~~RA~~ly~~  190 (209)
                      +++++| +|+++.|.|+|+|.+    ++|+|+|+++|+++++ ++.+.+.+.+..+++|+++|++||+++||+
T Consensus        81 ~~~~~G-~f~~~~g~w~f~~~~----~gt~v~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~f~~r~~~~~~~  148 (148)
T 1t17_A           81 VSLLYG-PFKRLNNGWRFMPEG----DATRVEFVIEFAFKSALLDAMLAANVDRAAGKLIACFEARAQQLHGA  148 (148)
T ss_dssp             EEESST-TSSCEEEEEEEEEET----TEEEEEEEEEECCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             EEECCC-ChhccEEEEEEEECC----CCeEEEEEEEEEECcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCc
Confidence            999999 699999999999987    3599999999999999 566667777777999999999999999985



>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Back     alignment and structure
>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Back     alignment and structure
>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Back     alignment and structure
>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Back     alignment and structure
>3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Back     alignment and structure
>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 Back     alignment and structure
>2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Back     alignment and structure
>3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Back     alignment and structure
>3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Back     alignment and structure
>3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8 Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Back     alignment and structure
>4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Back     alignment and structure
>3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Back     alignment and structure
>3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Back     alignment and structure
>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0 Back     alignment and structure
>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI structure initiative; 2.10A {Chromobacterium violaceum} SCOP: d.129.3.5 Back     alignment and structure
>3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3zvu_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Back     alignment and structure
>1xfs_A NC_840354, conserved hypothetical protein; structural genomics, protein structure initiative, NESG, ALP protein, PSI; 1.70A {Nitrosomonas europaea} SCOP: d.129.3.5 Back     alignment and structure
>2leq_A Uncharacterized protein; start domains, structural genomics, PSI-biology, protein STR initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 Back     alignment and structure
>2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A Back     alignment and structure
>2lak_A AHSA1-like protein RHE_CH02687; NESG, structural genomics, northeast structural genomics CON PSI-biology, structure genomics, unknown function; NMR {Rhizobium etli} Back     alignment and structure
>2lgh_A Uncharacterized protein; AHSA1, start domain, COG3832, PF08327, HSP90, heat shock, ST genomics, PSI-biology; NMR {Aeromonas hydrophila subsp} Back     alignment and structure
>2lcg_A Uncharacterized protein; start domain, structural genomics, northeast structural GENO consortium, NESG, unknown function, AHSA1; NMR {Ralstonia metallidurans} Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A Back     alignment and structure
>3put_A Hypothetical conserved protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.83A {Rhizobium etli cfn 42} PDB: 3otl_A* Back     alignment and structure
>2l8o_A Uncharacterized protein; mixed alpha-beta protein, PSI-biology, structural genomics, structure initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, structure initiative; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 Back     alignment and structure
>3pu2_A Uncharacterized protein; SRPBCC superfamily, PSI-biology, NESG, RHR263, structural GE protein structure initiative; HET: MSE; 2.61A {Rhodobacter sphaeroides} Back     alignment and structure
>3q64_A MLL3774 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.50A {Mesorhizobium loti} Back     alignment and structure
>2ldk_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Arthrobacter aurescens} Back     alignment and structure
>3rd6_A MLL3558 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.80A {Mesorhizobium loti} Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>1xn5_A BH1534 unknown conserved protein; structural genomics, protein structure initiative, PSI, BACI halodurans protein BH1534, alpha + beta; NMR {Bacillus halodurans} SCOP: d.129.3.5 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 Back     alignment and structure
>2lf2_A Uncharacterized protein; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>3q6a_A Uncharacterized protein; structural genomics, PSI-biology; 1.80A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2nn5_A Hypothetical protein EF_2215; structural genomics, APC29336, PSI-2, structure initiative; HET: MSE; 1.45A {Enterococcus faecalis} SCOP: d.129.3.5 Back     alignment and structure
>3eli_A AHSA1, AHA1 domain protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} SCOP: d.129.3.5 Back     alignment and structure
>2l9p_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Staphylococcus epidermidis} Back     alignment and structure
>2k5g_A Uncharacterized protein; structural genomiccs, protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} SCOP: d.129.3.5 Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 4ds8_A* 3klx_A* 4dsb_A* 4dsc_A* Back     alignment and structure
>3q63_A MLL2253 protein; structural genomics, PSI-biology, protein structure initiati alpha-beta protein, unknown, structure genomics; 2.00A {Mesorhizobium loti} Back     alignment and structure
>2kew_A Uncharacterized protein YNDB; start domain, resonance assignments, lipid binding, structural genomics, unknown FU PSI-2; NMR {Bacillus subtilis subsp} PDB: 2kte_A Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>3uid_A Putative uncharacterized protein; SRPBCC superfamily, beta sandwich, function, structural genomics, TB structural genomics conso TBSGC; 1.57A {Mycobacterium smegmatis} SCOP: d.129.3.0 Back     alignment and structure
>4fpw_A CALU16; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.50A {Micromonospora echinospora} PDB: 2luz_A Back     alignment and structure
>2luz_A CALU16; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Micromonospora echinospora} Back     alignment and structure
>1x53_A Activator of 90 kDa heat shock protein ATPase homolog 1; AHA1, HSP90,DUF704, C-terminal domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.129.3.5 Back     alignment and structure
>3ni8_A PFC0360W protein; heat shock, malaria, ATPase, structural genomics consortium, unknown function; 2.50A {Plasmodium falciparum} Back     alignment and structure
>1zxf_A CALC; SELF-sacrificing resistance protein, structural genomics, PSI, protein structure initiative; NMR {Micromonospora echinospora} SCOP: d.129.3.5 PDB: 2gkc_A* 2gkd_A 2l65_A* Back     alignment and structure
>2ffs_A Hypothetical protein PA1206; 7-stranded beta sheet, C-terminal helix, structural genomics protein structure initiative; HET: MSE; 2.50A {Pseudomonas aeruginosa} SCOP: d.129.3.7 Back     alignment and structure
>2lio_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1t17a_148 d.129.3.6 (A:) Hypothetical protein CC1736 {Caulob 6e-16
d2d4ra1146 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 1e-14
d2rera1155 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, c 9e-11
d2pcsa1147 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {G 2e-10
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} Length = 148 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: oligoketide cyclase/dehydrase-like
domain: Hypothetical protein CC1736
species: Caulobacter crescentus [TaxId: 155892]
 Score = 69.8 bits (170), Expect = 6e-16
 Identities = 30/148 (20%), Positives = 57/148 (38%), Gaps = 15/148 (10%)

Query: 50  RKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSEKK----IIGSLTIGFPPIVESY 105
            K++ Y+ +Q++E+V DV+ Y  FVP+                 +     +GF  + E +
Sbjct: 7   TKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFSFLREKF 66

Query: 106 TSNVTLDRPKLIKANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYME---KAFFAEAE 162
            + V  D+             F  L   WRF         +  ++F +E   K+   +A 
Sbjct: 67  ATRVRRDKDARSIDVSLLYGPFKRLNNGWRF----MPEGDATRVEFVIEFAFKSALLDAM 122

Query: 163 M-RYGNRVLLTSMQMEKAFFAEAEMRYG 189
           +    +R      ++   F A A+  +G
Sbjct: 123 LAANVDRAA---GKLIACFEARAQQLHG 147


>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Length = 146 Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Length = 155 Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1t17a_148 Hypothetical protein CC1736 {Caulobacter crescentu 100.0
d2d4ra1146 Hypothetical protein TTHA0849 {Thermus thermophilu 99.94
d2pcsa1147 Hypothetical protein GKP20 {Geobacillus kaustophil 99.84
d2rera1155 Multifunctional enzyme TcmN, cyclase/aromatase dom 99.84
d2ns9a1147 Hypothetical protein APE2225 {Aeropyrum pernix [Ta 99.66
d2b79a1137 Hypothetical protein SMU440 {Streptococcus mutans 99.6
d3cnwa1138 Uncharacterized protein XoxI {Bacillus cereus [Tax 99.59
d2qpva1133 Uncharacterized protein Atu1531 {Agrobacterium tum 98.99
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 98.74
d2bk0a1153 Major allergen api g 1 {Celery (Apium graveolens) 98.73
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 98.61
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 98.59
d1fm4a_159 Major tree pollen allergen {European white birch ( 98.57
d1icxa_155 Plant pathogenesis-related protein PR10 {Yellow lu 98.56
d1txca1147 Plant pathogenesis-related protein PR10 {Jicama (P 98.54
d1xdfa1157 Plant pathogenesis-related protein PR10 {Yellow lu 98.5
d1e09a_159 Major tree pollen allergen {Sweet cherry (Prunus a 98.47
d1xuva_163 Hypothetical protein MM0500 {Methanosarcina mazei 98.4
d2il5a1164 Hypothetical protein SA2116 {Staphylococcus aureus 98.28
d1xfsa_165 Hypothetical protein NE0264 {Nitrosomonas europaea 98.23
d1xn5a_138 Hypothetical protein BH1534 {Bacillus halodurans [ 98.21
d1z94a1143 Hypothetical protein CV1439 {Chromobacterium viola 98.03
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 97.96
d3elia1143 Uncharacterized protein SPO3351 {Silicibacter pome 97.71
d1xn6a_143 Hypothetical protein BC4709 {Bacillus cereus [TaxI 97.57
d2k5ga1183 Uncharacterized protein BPP1335 {Bordetella parape 97.5
d2nn5a1160 Hypothetical protein EF2215 {Enterococcus faecalis 97.34
d1vjha_120 Hypothetical protein At1G24000 {Thale cress (Arabi 97.19
d1zxfa1155 Calicheamicin gene cluster protein CalC {Micromono 97.09
d1x53a1132 Activator of 90 kda heat shock protein ATPase homo 96.65
d2ffsa1151 Hypothetical protein PA1206 {Pseudomonas aeruginos 95.84
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: oligoketide cyclase/dehydrase-like
domain: Hypothetical protein CC1736
species: Caulobacter crescentus [TaxId: 155892]
Probab=100.00  E-value=2.5e-35  Score=230.05  Aligned_cols=142  Identities=23%  Similarity=0.352  Sum_probs=126.1

Q ss_pred             ceEEEEEEEEcCCHHHHHHHHhchhcccccCCCcceEEEEEecC----CeEEEEEEEeeCCceeEEEEEEEecCCC-eEE
Q psy15938         44 KKEYLGRKLVGYSREQMYEVVSDVENYKNFVPFCKKSVVTYKSE----KKIIGSLTIGFPPIVESYTSNVTLDRPK-LIK  118 (209)
Q Consensus        44 ~~~~~~~~~I~~~~~~vf~vV~DVe~YpeFlP~c~~s~Vle~~~----~~~~a~l~v~~~~~~~~~tsrv~~~~~~-~I~  118 (209)
                      |+.++.+++|+|||++||++|+|||+||+|+|||++++|+++.+    ....+++.++++++..+|++++.+.++. .+.
T Consensus         1 m~~~~~~~vi~~~~e~vf~vV~Dve~Yp~FlP~c~~~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (148)
T d1t17a_           1 MHRHVVTKVLPYTPDQLFELVGDVDAYPKFVPWITGMRTWNGRVDGAVSTVDAEAQVGFSFLREKFATRVRRDKDARSID   80 (148)
T ss_dssp             CCEEEEEEEESSCTHHHHHHHTTTTCCSSCCSSCCCCCEEEEEEETTEEEEEEEEECSTTSSCCEEEEEEEEETTTCEEE
T ss_pred             CCcceEEEEeCCCHHHHHHHHHHHHhhhhhccccCccEEEecccccccceeeEEEEEEeeeeEEEEEEEeeecCCceEEE
Confidence            67889999999999999999999999999999999999998754    3688999999999999999999988865 567


Q ss_pred             EEeecCcccceeeeEEEEEeCCCCCCCceEEEEEEEEEeCcc-hhhhhcchhhhhHHHHHHHHHHHHHHHhCC
Q psy15938        119 ANCFDGKLFDHLVTMWRFHRGLEDVPQSCVIDFYMEKAFFAE-AEMRYGNRVLLTSMQMEKAFFAEAEMRYGK  190 (209)
Q Consensus       119 ~~~~~G~~F~~l~g~W~f~p~~~~~~~~T~V~f~l~fef~~p-~~~~~~~~~~~~~~~ml~af~~RA~~ly~~  190 (209)
                      +.+.+| +|+++.|.|.|.+.+    ++|+|+|+++|+|++| .+.+.+.+.+..+++|++||++||+++||.
T Consensus        81 ~~~~~g-~f~~l~~~W~f~~~~----~~T~V~~~l~fe~~~~l~~~~~~~~~~~~~~~~i~aF~~Ra~~lyg~  148 (148)
T d1t17a_          81 VSLLYG-PFKRLNNGWRFMPEG----DATRVEFVIEFAFKSALLDAMLAANVDRAAGKLIACFEARAQQLHGA  148 (148)
T ss_dssp             EEESST-TSSCEEEEEEEEEET----TEEEEEEEEEECCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             EeccCc-hhhhcccceeeccCC----CceEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCc
Confidence            777777 799999999999976    5899999999999999 555555555555999999999999999994



>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Back     information, alignment and structure
>d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Back     information, alignment and structure
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Back     information, alignment and structure
>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2k5ga1 d.129.3.5 (A:1-183) Uncharacterized protein BPP1335 {Bordetella parapertussis [TaxId: 519]} Back     information, alignment and structure
>d2nn5a1 d.129.3.5 (A:1-160) Hypothetical protein EF2215 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} Back     information, alignment and structure
>d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure