Diaphorina citri psyllid: psy15942

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-

MSNYANNSKATEIMLGSQKNNALEASRVPMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGSTRAPFRSFPLSKWQLERTPLVHFFKVMKV

ccccccccccHHEEccccccccccccccccccccccccccccEEEcccccEEcccHHHHHcccccccEEEEEcccccccccccCEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc

****************************PMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSAD**TRAPFRSFPLSKWQLERTPLVHFFKVMKV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016311 [BP]	dephosphorylation	probable	GO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016791 [MF]	phosphatase activity	probable	GO:0042578, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OUD, chain A
Confidence level:very confident
Coverage over the Query: 43-183
View the alignment between query and template
View the model in PyMOL