Psyllid ID: psy15942
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| 156382728 | 176 | predicted protein [Nematostella vectensi | 0.492 | 0.590 | 0.438 | 2e-18 | |
| 221109808 | 184 | PREDICTED: phosphatidylglycerophosphatas | 0.454 | 0.521 | 0.46 | 4e-18 | |
| 301628461 | 138 | PREDICTED: protein-tyrosine phosphatase | 0.545 | 0.833 | 0.384 | 7e-17 | |
| 115630616 | 192 | PREDICTED: protein-tyrosine phosphatase | 0.393 | 0.432 | 0.5 | 1e-16 | |
| 442756131 | 195 | Putative dual specificity phosphatase [I | 0.507 | 0.548 | 0.396 | 9e-16 | |
| 344281039 | 200 | PREDICTED: protein-tyrosine phosphatase | 0.431 | 0.455 | 0.445 | 9e-16 | |
| 241680574 | 198 | dual specificity phosphatase, putative [ | 0.507 | 0.540 | 0.396 | 1e-15 | |
| 346986298 | 201 | protein-tyrosine phosphatase mitochondri | 0.431 | 0.452 | 0.456 | 5e-15 | |
| 395815683 | 200 | PREDICTED: protein-tyrosine phosphatase | 0.540 | 0.57 | 0.396 | 6e-15 | |
| 348558790 | 169 | PREDICTED: protein-tyrosine phosphatase | 0.488 | 0.609 | 0.413 | 7e-15 |
| >gi|156382728|ref|XP_001632704.1| predicted protein [Nematostella vectensis] gi|156219764|gb|EDO40641.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
Score = 98.6 bits (244), Expect = 2e-18, Method: Compositional matrix adjust.
Identities = 46/105 (43%), Positives = 66/105 (62%), Gaps = 1/105 (0%)
Query: 71 LCMRKAEWEGRGVAHLQLDTIEF-EAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRS 129
LC K EW GV L+L T++F APS + +G++FI+ + G Y+HCKAGR RS
Sbjct: 64 LCNSKQEWFAWGVTQLRLATVDFGNAPSFAQLLEGVKFIEDMRSKGDSVYVHCKAGRGRS 123
Query: 130 ATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYN 174
TL ACYL+KN N+NP++A +I KR QIR+ + + Q ++
Sbjct: 124 TTLVACYLMKNKNLNPEEAHLFIKSKRPQIRLASQQWIALQQFHD 168
|
Source: Nematostella vectensis Species: Nematostella vectensis Genus: Nematostella Family: Edwardsiidae Order: Actiniaria Class: Anthozoa Phylum: Cnidaria Superkingdom: Eukaryota |
| >gi|221109808|ref|XP_002160979.1| PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|301628461|ref|XP_002943370.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like, partial [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|115630616|ref|XP_001188241.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|442756131|gb|JAA70225.1| Putative dual specificity phosphatase [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|344281039|ref|XP_003412288.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like [Loxodonta africana] | Back alignment and taxonomy information |
|---|
| >gi|241680574|ref|XP_002412690.1| dual specificity phosphatase, putative [Ixodes scapularis] gi|215506492|gb|EEC15986.1| dual specificity phosphatase, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|346986298|ref|NP_001231306.1| protein-tyrosine phosphatase mitochondrial 1 [Sus scrofa] | Back alignment and taxonomy information |
|---|
| >gi|395815683|ref|XP_003781354.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1 [Otolemur garnettii] | Back alignment and taxonomy information |
|---|
| >gi|348558790|ref|XP_003465199.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like [Cavia porcellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| UNIPROTKB|F1SIF5 | 201 | PTPMT1 "Uncharacterized protei | 0.535 | 0.562 | 0.387 | 2e-17 | |
| UNIPROTKB|J9NTP3 | 275 | PTPMT1 "Uncharacterized protei | 0.431 | 0.330 | 0.456 | 6.7e-17 | |
| UNIPROTKB|Q2NKZ7 | 270 | PTPMT1 "Uncharacterized protei | 0.573 | 0.448 | 0.346 | 2.3e-16 | |
| ZFIN|ZDB-GENE-070112-272 | 183 | ptpmt1 "protein tyrosine phosp | 0.483 | 0.557 | 0.378 | 7.7e-16 | |
| MGI|MGI:1913711 | 193 | Ptpmt1 "protein tyrosine phosp | 0.450 | 0.492 | 0.406 | 1.3e-15 | |
| RGD|1589783 | 193 | Ptpmt1 "protein tyrosine phosp | 0.450 | 0.492 | 0.395 | 2e-15 | |
| UNIPROTKB|Q8WUK0 | 201 | PTPMT1 "Phosphatidylglyceropho | 0.431 | 0.452 | 0.423 | 3.3e-15 | |
| WB|WBGene00009207 | 189 | F28C6.8 [Caenorhabditis elegan | 0.573 | 0.640 | 0.330 | 4.9e-14 | |
| UNIPROTKB|I2HA91 | 189 | F28C6.8 "Protein F28C6.8, isof | 0.573 | 0.640 | 0.330 | 4.9e-14 | |
| UNIPROTKB|Q93622 | 150 | F28C6.8 "Protein F28C6.8, isof | 0.573 | 0.806 | 0.330 | 4.9e-14 |
| UNIPROTKB|F1SIF5 PTPMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 213 (80.0 bits), Expect = 2.0e-17, P = 2.0e-17
Identities = 45/116 (38%), Positives = 66/116 (56%)
Query: 71 LCMRKAEWEGRGVAHLQLDTIEFEA-PSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRS 129
LC EW+ GV L+L T++ P+L ++KG++F K G Y+HCKAGRSRS
Sbjct: 80 LCNSSKEWKNLGVEQLRLSTVDMTGVPTLANLQKGVQFALKYQSQGQSVYVHCKAGRSRS 139
Query: 130 ATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIY--GSADGST 183
AT+ A YLI+ YN P++AV+ IT R I I + + + + + G+A T
Sbjct: 140 ATMVAAYLIQMYNWTPEEAVRAITKIRSHIYIRPGQLEVLKEFHKVITAGAAKNDT 195
|
|
| UNIPROTKB|J9NTP3 PTPMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2NKZ7 PTPMT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070112-272 ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913711 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1589783 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WUK0 PTPMT1 "Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00009207 F28C6.8 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I2HA91 F28C6.8 "Protein F28C6.8, isoform b" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q93622 F28C6.8 "Protein F28C6.8, isoform a" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 1e-16 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 5e-16 | |
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 5e-14 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 1e-09 | |
| PTZ00242 | 166 | PTZ00242, PTZ00242, protein tyrosine phosphatase; | 1e-05 | |
| PTZ00393 | 241 | PTZ00393, PTZ00393, protein tyrosine phosphatase; | 7e-05 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 0.002 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 0.002 |
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
Score = 72.7 bits (179), Expect = 1e-16
Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
Query: 85 HLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMN 144
+ ++ S Y + + +EFI Q GG +HC+AG SRSATL YL+K N++
Sbjct: 42 GIPVEDNHETNISKY-LPEAVEFIDDAIQKGGKVLVHCQAGISRSATLIIAYLMKTRNLS 100
Query: 145 PDDAVKYITYKRKQIR 160
++A ++ +R I
Sbjct: 101 LNEAYSFVKERRPIIS 116
|
Ser/Thr and Tyr protein phosphatases. The enzyme's tertiary fold is highly similar to that of tyrosine-specific phosphatases, except for a "recognition" region. Length = 131 |
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|185524 PTZ00242, PTZ00242, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240399 PTZ00393, PTZ00393, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.94 | |
| KOG1718|consensus | 198 | 99.94 | ||
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.94 | |
| KOG1717|consensus | 343 | 99.93 | ||
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.93 | |
| KOG1716|consensus | 285 | 99.92 | ||
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.92 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.92 | |
| KOG1720|consensus | 225 | 99.89 | ||
| KOG1719|consensus | 183 | 99.87 | ||
| PRK12361 | 547 | hypothetical protein; Provisional | 99.87 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.79 | |
| KOG2836|consensus | 173 | 99.71 | ||
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.59 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.59 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 99.55 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 99.54 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.53 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 99.48 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 99.47 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 99.43 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 99.42 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 99.42 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 99.39 | |
| KOG0792|consensus | 1144 | 99.31 | ||
| KOG0790|consensus | 600 | 99.28 | ||
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 99.26 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.16 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 99.11 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 99.09 | |
| KOG0791|consensus | 374 | 99.06 | ||
| KOG2283|consensus | 434 | 98.99 | ||
| KOG4228|consensus | 1087 | 98.97 | ||
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 98.86 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 98.84 | |
| KOG0793|consensus | 1004 | 98.77 | ||
| KOG0789|consensus | 415 | 98.73 | ||
| KOG4228|consensus | 1087 | 98.65 | ||
| KOG2386|consensus | 393 | 98.55 | ||
| PLN02727 | 986 | NAD kinase | 98.54 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 98.31 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 98.14 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 97.98 | |
| KOG1572|consensus | 249 | 97.79 | ||
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 97.76 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 97.27 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 96.66 | |
| KOG4471|consensus | 717 | 95.97 | ||
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 92.57 | |
| KOG1089|consensus | 573 | 90.77 | ||
| PLN02160 | 136 | thiosulfate sulfurtransferase | 80.52 |
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
Probab=99.94 E-value=2.2e-26 Score=174.99 Aligned_cols=130 Identities=24% Similarity=0.320 Sum_probs=114.9
Q ss_pred cccccccccccchhhhh---hhcCceEEEEeecccccccccCCceEEEEEcCC-CCCCcHHHHHHHHHHHHHHHHcCCeE
Q psy15942 43 ILCMRKAVAFLSPAMTA---AEFNLCIARDILCMRKAEWEGRGVAHLQLDTIE-FEAPSLYAIEKGLEFIQKVAQSGGVT 118 (211)
Q Consensus 43 il~~~~~ig~~~~~~~~---~~~~i~~i~~~~~~~~~~~~~~~i~~~~~p~~D-~~~~~~~~l~~~i~~i~~~~~~~~~V 118 (211)
|++ ++|+|+.....+. ++.+++.|+++...... ....+++|+++|+.| ...+..+.+..+++||+....+|++|
T Consensus 4 I~~-~l~~G~~~~~~~~~~l~~~gi~~Vi~l~~~~~~-~~~~~~~~~~ipi~D~~~~~~~~~~~~~~~~i~~~~~~~~~V 81 (138)
T smart00195 4 ILP-HLYLGSYSSALNLALLKKLGITHVINVTNEVPN-LNKKGFTYLGVPILDNTETKISPYFPEAVEFIEDAEKKGGKV 81 (138)
T ss_pred EeC-CeEECChhHcCCHHHHHHcCCCEEEEccCCCCC-CCCCCCEEEEEECCCCCCCChHHHHHHHHHHHHHHhcCCCeE
Confidence 455 7889888777654 45799999887655432 346789999999999 67778889999999999999999999
Q ss_pred EEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHH
Q psy15942 119 YIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYN 174 (211)
Q Consensus 119 lVHC~~G~gRS~t~~~ayLm~~~~~~~~~A~~~vr~~Rp~~~~~~~q~~~L~~~~~ 174 (211)
+|||.+|+||||+++++|||...||++++|+++++++||.+.|+++|+++|..||+
T Consensus 82 lVHC~~G~~RS~~v~~~yl~~~~~~~~~~A~~~v~~~R~~~~p~~~~~~qL~~~e~ 137 (138)
T smart00195 82 LVHCQAGVSRSATLIIAYLMKYRNLSLNDAYDFVKDRRPIISPNFGFLRQLIEYER 137 (138)
T ss_pred EEECCCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHCCccCCCHhHHHHHHHHhh
Confidence 99999999999999999999999999999999999999999999999999999986
|
|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG2386|consensus | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG1572|consensus | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >KOG4471|consensus | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >KOG1089|consensus | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 211 | ||||
| 3rgo_A | 157 | Crystal Structure Of Ptpmt1 Length = 157 | 9e-16 | ||
| 3rgq_A | 156 | Crystal Structure Of Ptpmt1 In Complex With Pi(5)p | 1e-14 | ||
| 2wgp_A | 190 | Crystal Structure Of Human Dual Specificity Phospha | 5e-07 | ||
| 1ohc_A | 348 | Structure Of The Proline Directed Phosphatase Cdc14 | 7e-05 | ||
| 1m3g_A | 145 | Solution Structure Of The Catalytic Domain Of Mapk | 9e-05 | ||
| 2oud_A | 177 | Crystal Structure Of The Catalytic Domain Of Human | 1e-04 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 1e-04 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 1e-04 | ||
| 1zzw_A | 149 | Crystal Structure Of Catalytic Domain Of Human Map | 1e-04 | ||
| 4erc_A | 150 | Structure Of Vhz Bound To Metavanadate Length = 150 | 3e-04 | ||
| 2r0b_A | 154 | Crystal Structure Of Human Tyrosine Phosphatase-lik | 3e-04 | ||
| 2e0t_A | 151 | Crystal Structure Of Catalytic Domain Of Dual Speci | 3e-04 | ||
| 2g6z_A | 211 | Crystal Structure Of Human Dusp5 Length = 211 | 5e-04 | ||
| 3lj8_A | 146 | Crystal Structure Of Mkp-4 Length = 146 | 5e-04 | ||
| 2img_A | 151 | Crystal Structure Of Dual Specificity Protein Phosp | 6e-04 |
| >pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 | Back alignment and structure |
|
| >pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 | Back alignment and structure |
| >pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 | Back alignment and structure |
| >pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 | Back alignment and structure |
| >pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 | Back alignment and structure |
| >pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 | Back alignment and structure |
| >pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 | Back alignment and structure |
| >pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 | Back alignment and structure |
| >pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 | Back alignment and structure |
| >pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 | Back alignment and structure |
| >pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 | Back alignment and structure |
| >pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 5e-28 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 2e-24 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 4e-19 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 3e-18 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 2e-17 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 3e-17 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 3e-17 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 3e-17 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 5e-17 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 6e-17 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 7e-17 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 7e-17 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 1e-16 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 1e-16 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 1e-16 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 2e-16 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 2e-16 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 2e-16 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 3e-16 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 4e-16 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 4e-16 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 6e-16 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 2e-15 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 3e-15 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 8e-15 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 1e-14 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 4e-14 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 4e-14 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 7e-14 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 1e-13 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 8e-12 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 1e-11 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 6e-08 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 8e-08 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 2e-07 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 2e-05 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 2e-07 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 1e-05 |
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
Score = 102 bits (256), Expect = 5e-28
Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 1/106 (0%)
Query: 71 LCMRKAEWEGRGVAHLQLDTI-EFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRS 129
LC EW+ GV L+L T+ P+L + KG++F K G Y+HCKAGRSRS
Sbjct: 44 LCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRS 103
Query: 130 ATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNI 175
AT+ A YLI+ +N +P++A++ I R I I ++ + + +
Sbjct: 104 ATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKE 149
|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 99.97 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.96 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.96 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.95 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.95 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.95 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.95 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.95 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.95 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.95 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.95 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.95 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.94 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.94 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.94 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.94 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.94 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.94 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.93 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.93 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.93 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.93 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.92 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.92 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.88 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.88 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.88 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.87 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.86 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.85 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.85 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.84 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.77 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.77 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.71 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.69 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.69 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 99.62 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 99.61 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 99.6 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 99.59 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 99.59 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 99.59 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 99.58 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 99.58 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 99.57 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 99.57 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 99.57 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 99.56 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 99.56 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 99.56 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 99.55 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.55 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 99.55 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 99.54 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 99.54 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 99.54 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 99.53 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 99.52 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 99.52 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 99.51 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 99.51 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 99.5 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 99.49 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 99.48 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 99.47 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.47 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 99.47 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.46 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.44 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.43 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.43 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.41 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.4 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.39 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.36 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.36 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.35 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.33 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.28 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.26 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.23 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 98.68 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 97.38 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 92.84 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 92.05 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 91.13 |
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
Probab=99.97 E-value=8.3e-30 Score=197.94 Aligned_cols=138 Identities=12% Similarity=0.055 Sum_probs=118.8
Q ss_pred cccccccccccchhhhh---hhcCceEEEEeecccccccccCCceEEEEEcCC-CCCCcHHHHHHHHHHHHHHHHcCCeE
Q psy15942 43 ILCMRKAVAFLSPAMTA---AEFNLCIARDILCMRKAEWEGRGVAHLQLDTIE-FEAPSLYAIEKGLEFIQKVAQSGGVT 118 (211)
Q Consensus 43 il~~~~~ig~~~~~~~~---~~~~i~~i~~~~~~~~~~~~~~~i~~~~~p~~D-~~~~~~~~l~~~i~~i~~~~~~~~~V 118 (211)
|++ ++|+|+.....+. ++.++++|+++....+..+ ..+++|+++|+.| ...+..+.++++++||++++..|++|
T Consensus 13 I~~-~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~~~~-~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~~~~V 90 (161)
T 3emu_A 13 IIQ-YIHLGSFLNAHNVDYIHNNNISSILLVGIEVPSLF-KDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQRKEGV 90 (161)
T ss_dssp EET-TEEEEETTGGGCHHHHHHTTEEEEEEEC--------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHTTCEE
T ss_pred EEC-CEEECChHHhhCHHHHHHCCCCEEEEeCCCCcccc-CCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhcCCeE
Confidence 666 7999999887655 5679999998876544433 4589999999999 66667778999999999999999999
Q ss_pred EEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHhcCCCCC
Q psy15942 119 YIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGS 182 (211)
Q Consensus 119 lVHC~~G~gRS~t~~~ayLm~~~~~~~~~A~~~vr~~Rp~~~~~~~q~~~L~~~~~~l~~~~~~ 182 (211)
+|||.+|+|||+++++||||...||++++|+++||++||.+.||.+|++||..||+.|.++...
T Consensus 91 lVHC~~G~sRS~~vv~ayLm~~~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~~~~ 154 (161)
T 3emu_A 91 LIISGTGVNKAPAIVIAFLMYYQRLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKMNSE 154 (161)
T ss_dssp EEEESSSSSHHHHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHHTCC
T ss_pred EEEcCCCCcHHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcCCCC
Confidence 9999999999999999999999999999999999999999999999999999999999876643
|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 211 | ||||
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 2e-15 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 2e-14 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 1e-11 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 4e-11 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 7e-11 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 3e-09 | |
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 1e-08 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 2e-08 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 6e-08 | |
| d1xria_ | 151 | c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal | 3e-05 |
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Proline directed phosphatase CDC14b2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 69.3 bits (169), Expect = 2e-15
Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 3/89 (3%)
Query: 75 KAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTA 134
+ G H L + P+ ++ EF+ + G +H KAG R+ TL A
Sbjct: 72 AKRFTDAGFDHHDLFFADGSTPTDAIVK---EFLDICENAEGAIAVHSKAGLGRTGTLIA 128
Query: 135 CYLIKNYNMNPDDAVKYITYKRKQIRITK 163
CY++K+Y M + + ++ R I
Sbjct: 129 CYIMKHYRMTAAETIAWVRICRPGSVIGP 157
|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.96 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 99.95 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.95 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.91 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.89 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.87 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.87 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.84 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 99.49 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 99.48 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 99.46 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.44 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.42 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 99.42 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 99.4 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 99.36 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 99.34 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 99.34 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 99.31 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 99.31 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 99.3 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 97.73 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 97.03 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 93.4 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 87.29 |
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]
Probab=99.96 E-value=3.6e-29 Score=188.93 Aligned_cols=133 Identities=17% Similarity=0.157 Sum_probs=117.3
Q ss_pred cccccccccccchhhhh---hhcCceEEEEeecccccc-cccCCceEEEEEcCC-CCCCcHHHHHHHHHHHHHHHHcCCe
Q psy15942 43 ILCMRKAVAFLSPAMTA---AEFNLCIARDILCMRKAE-WEGRGVAHLQLDTIE-FEAPSLYAIEKGLEFIQKVAQSGGV 117 (211)
Q Consensus 43 il~~~~~ig~~~~~~~~---~~~~i~~i~~~~~~~~~~-~~~~~i~~~~~p~~D-~~~~~~~~l~~~i~~i~~~~~~~~~ 117 (211)
|++ ++|+|+...+.+. ++.++++|+++....+.. ....++.|+++|+.| +..+..+.++.+++||++++.+|++
T Consensus 7 I~p-~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~~~~ 85 (144)
T d1mkpa_ 7 ILP-FLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCG 85 (144)
T ss_dssp EET-TEEEECTTSCCCHHHHHHTTEEEEEECCSSCCCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHTTCE
T ss_pred EEC-CEEECChhHhcCHHHHHhCCCcEEEEccccCCccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhccce
Confidence 565 7899998876655 556899998876554443 336789999999999 6777888999999999999999999
Q ss_pred EEEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHh
Q psy15942 118 TYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIY 176 (211)
Q Consensus 118 VlVHC~~G~gRS~t~~~ayLm~~~~~~~~~A~~~vr~~Rp~~~~~~~q~~~L~~~~~~l 176 (211)
|||||.+|+|||+++++||||...|+++++|+++|+++||.+.||.+|++||.+||+.|
T Consensus 86 VlVHC~~G~~RS~~vv~aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L 144 (144)
T d1mkpa_ 86 VLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL 144 (144)
T ss_dssp EEEECSSCSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHTC
T ss_pred EEEEecccccchHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhhC
Confidence 99999999999999999999999999999999999999999999999999999999864
|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|