Psyllid ID: psy15942

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MSNYANNSKATEIMLGSQKNNALEASRVPMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGSTRAPFRSFPLSKWQLERTPLVHFFKVMKV
ccccccccccHHEEccccccccccccccccccccccccccccEEEcccccEEcccHHHHHcccccccEEEEEcccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccc
cccccccccccHHHEHHHHccHHccccccccHHHccHHcccccEEEEcccccccHHHHHHHcccEEEEEEEcccHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccccccHHccccccccccEEEEEEc
msnyannsKATEIMLGsqknnaleasrvpmtaaEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAewegrgvahlqLDTIEFEAPSLYAIEKGLEFIQKVAQsggvtyihckagrsrsaTLTACYLIknynmnpddAVKYITYKRKQIRITKTEKAQIDQCYniygsadgstrapfrsfplskwqlertplvhfFKVMKV
msnyannskatEIMLGSQKNNALEASRVPMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTyihckagrsrSATLTACYLIKnynmnpddaVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGSTRAPFRSFplskwqlertplvhffkvmkv
MSNYANNSKATEIMLGSQKNNALEASRVPMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGSTRAPFRSFPLSKWQLERTPLVHFFKVMKV
****************************PMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGSTRAPFRSFPLSKWQLERTPLVHFFKV***
*********************************EFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYN*************************TPLVHFFKVMKV
********KATEIMLGSQKNNALEASRVPMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGSTRAPFRSFPLSKWQLERTPLVHFFKVMKV
**********TEIMLGSQKNNALEASRVPMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSAD**TRAPFRSFPLSKWQLERTPLVHFFKVMKV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNYANNSKATEIMLGSQKNNALEASRVPMTAAEFNLCIARDILCMRKAVAFLSPAMTAAEFNLCIARDILCMRKAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGSTRAPFRSFPLSKWQLERTPLVHFFKVMKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query211 2.2.26 [Sep-21-2011]
Q66GT5193 Phosphatidylglycerophosph no N/A 0.450 0.492 0.406 1e-14
P0C089193 Phosphatidylglycerophosph no N/A 0.450 0.492 0.395 1e-14
Q8WUK0201 Phosphatidylglycerophosph yes N/A 0.431 0.452 0.423 4e-14
Q9ZQP1337 Putative dual specificity yes N/A 0.440 0.275 0.361 3e-12
Q86BN8200 Phosphatidylglycerophosph yes N/A 0.393 0.415 0.363 2e-10
Q9BY84 665 Dual specificity protein no N/A 0.279 0.088 0.389 8e-07
Q05922318 Dual specificity protein no N/A 0.331 0.220 0.342 3e-06
Q9JLY7198 Dual specificity protein no N/A 0.516 0.550 0.313 3e-06
Q13202 625 Dual specificity protein no N/A 0.279 0.094 0.389 4e-06
O09112 663 Dual specificity protein no N/A 0.279 0.088 0.389 4e-06
>sp|Q66GT5|PTPM1_MOUSE Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Mus musculus GN=Ptpmt1 PE=1 SV=1 Back     alignment and function desciption
 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 58/96 (60%), Gaps = 1/96 (1%)

Query: 71  LCMRKAEWEGRGVAHLQLDTIEFEA-PSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRS 129
           LC    EW+  GV  L+L T++    P+L  + KG++F  K    G   Y+HCKAGRSRS
Sbjct: 80  LCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRS 139

Query: 130 ATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTE 165
           AT+ A YLI+ +N +P++A++ I   R  I I  ++
Sbjct: 140 ATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQ 175
Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P0C089|PTPM1_RAT Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Rattus norvegicus GN=Ptpmt1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WUK0|PTPM1_HUMAN Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Homo sapiens GN=PTPMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQP1|DSP8_ARATH Putative dual specificity protein phosphatase DSP8 OS=Arabidopsis thaliana GN=DSP8 PE=2 SV=2 Back     alignment and function description
>sp|Q86BN8|PTPM1_DROME Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 OS=Drosophila melanogaster GN=Plip PE=2 SV=1 Back     alignment and function description
>sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 Back     alignment and function description
>sp|Q05922|DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus GN=Dusp2 PE=2 SV=2 Back     alignment and function description
>sp|Q9JLY7|DUS14_MOUSE Dual specificity protein phosphatase 14 OS=Mus musculus GN=Dusp14 PE=2 SV=2 Back     alignment and function description
>sp|Q13202|DUS8_HUMAN Dual specificity protein phosphatase 8 OS=Homo sapiens GN=DUSP8 PE=2 SV=2 Back     alignment and function description
>sp|O09112|DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus GN=Dusp8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
156382728176 predicted protein [Nematostella vectensi 0.492 0.590 0.438 2e-18
221109808184 PREDICTED: phosphatidylglycerophosphatas 0.454 0.521 0.46 4e-18
301628461138 PREDICTED: protein-tyrosine phosphatase 0.545 0.833 0.384 7e-17
115630616192 PREDICTED: protein-tyrosine phosphatase 0.393 0.432 0.5 1e-16
442756131195 Putative dual specificity phosphatase [I 0.507 0.548 0.396 9e-16
344281039200 PREDICTED: protein-tyrosine phosphatase 0.431 0.455 0.445 9e-16
241680574198 dual specificity phosphatase, putative [ 0.507 0.540 0.396 1e-15
346986298201 protein-tyrosine phosphatase mitochondri 0.431 0.452 0.456 5e-15
395815683200 PREDICTED: protein-tyrosine phosphatase 0.540 0.57 0.396 6e-15
348558790169 PREDICTED: protein-tyrosine phosphatase 0.488 0.609 0.413 7e-15
>gi|156382728|ref|XP_001632704.1| predicted protein [Nematostella vectensis] gi|156219764|gb|EDO40641.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 71  LCMRKAEWEGRGVAHLQLDTIEF-EAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRS 129
           LC  K EW   GV  L+L T++F  APS   + +G++FI+ +   G   Y+HCKAGR RS
Sbjct: 64  LCNSKQEWFAWGVTQLRLATVDFGNAPSFAQLLEGVKFIEDMRSKGDSVYVHCKAGRGRS 123

Query: 130 ATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYN 174
            TL ACYL+KN N+NP++A  +I  KR QIR+   +   + Q ++
Sbjct: 124 TTLVACYLMKNKNLNPEEAHLFIKSKRPQIRLASQQWIALQQFHD 168

Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota
>gi|221109808|ref|XP_002160979.1| PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1-like [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|301628461|ref|XP_002943370.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like, partial [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|115630616|ref|XP_001188241.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like protein-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|442756131|gb|JAA70225.1| Putative dual specificity phosphatase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|344281039|ref|XP_003412288.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like [Loxodonta africana] Back     alignment and taxonomy information
>gi|241680574|ref|XP_002412690.1| dual specificity phosphatase, putative [Ixodes scapularis] gi|215506492|gb|EEC15986.1| dual specificity phosphatase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|346986298|ref|NP_001231306.1| protein-tyrosine phosphatase mitochondrial 1 [Sus scrofa] Back     alignment and taxonomy information
>gi|395815683|ref|XP_003781354.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|348558790|ref|XP_003465199.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like [Cavia porcellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query211
UNIPROTKB|F1SIF5201 PTPMT1 "Uncharacterized protei 0.535 0.562 0.387 2e-17
UNIPROTKB|J9NTP3275 PTPMT1 "Uncharacterized protei 0.431 0.330 0.456 6.7e-17
UNIPROTKB|Q2NKZ7270 PTPMT1 "Uncharacterized protei 0.573 0.448 0.346 2.3e-16
ZFIN|ZDB-GENE-070112-272183 ptpmt1 "protein tyrosine phosp 0.483 0.557 0.378 7.7e-16
MGI|MGI:1913711193 Ptpmt1 "protein tyrosine phosp 0.450 0.492 0.406 1.3e-15
RGD|1589783193 Ptpmt1 "protein tyrosine phosp 0.450 0.492 0.395 2e-15
UNIPROTKB|Q8WUK0201 PTPMT1 "Phosphatidylglyceropho 0.431 0.452 0.423 3.3e-15
WB|WBGene00009207189 F28C6.8 [Caenorhabditis elegan 0.573 0.640 0.330 4.9e-14
UNIPROTKB|I2HA91189 F28C6.8 "Protein F28C6.8, isof 0.573 0.640 0.330 4.9e-14
UNIPROTKB|Q93622150 F28C6.8 "Protein F28C6.8, isof 0.573 0.806 0.330 4.9e-14
UNIPROTKB|F1SIF5 PTPMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 213 (80.0 bits), Expect = 2.0e-17, P = 2.0e-17
 Identities = 45/116 (38%), Positives = 66/116 (56%)

Query:    71 LCMRKAEWEGRGVAHLQLDTIEFEA-PSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRS 129
             LC    EW+  GV  L+L T++    P+L  ++KG++F  K    G   Y+HCKAGRSRS
Sbjct:    80 LCNSSKEWKNLGVEQLRLSTVDMTGVPTLANLQKGVQFALKYQSQGQSVYVHCKAGRSRS 139

Query:   130 ATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIY--GSADGST 183
             AT+ A YLI+ YN  P++AV+ IT  R  I I   +   + + + +   G+A   T
Sbjct:   140 ATMVAAYLIQMYNWTPEEAVRAITKIRSHIYIRPGQLEVLKEFHKVITAGAAKNDT 195
GO:0005739 "mitochondrion" evidence=IEA
GO:0004439 "phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity" evidence=IEA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IEA
GO:0004725 "protein tyrosine phosphatase activity" evidence=IEA
UNIPROTKB|J9NTP3 PTPMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2NKZ7 PTPMT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-272 ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1913711 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1589783 Ptpmt1 "protein tyrosine phosphatase, mitochondrial 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WUK0 PTPMT1 "Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00009207 F28C6.8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I2HA91 F28C6.8 "Protein F28C6.8, isoform b" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q93622 F28C6.8 "Protein F28C6.8, isoform a" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.691
3rd Layer3.1.3.16LOW CONFIDENCE prediction!
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 1e-16
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 5e-16
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 5e-14
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 1e-09
PTZ00242166 PTZ00242, PTZ00242, protein tyrosine phosphatase; 1e-05
PTZ00393241 PTZ00393, PTZ00393, protein tyrosine phosphatase; 7e-05
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 0.002
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 0.002
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information 
 Score = 72.7 bits (179), Expect = 1e-16
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 85  HLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTACYLIKNYNMN 144
            + ++       S Y + + +EFI    Q GG   +HC+AG SRSATL   YL+K  N++
Sbjct: 42  GIPVEDNHETNISKY-LPEAVEFIDDAIQKGGKVLVHCQAGISRSATLIIAYLMKTRNLS 100

Query: 145 PDDAVKYITYKRKQIR 160
            ++A  ++  +R  I 
Sbjct: 101 LNEAYSFVKERRPIIS 116

Ser/Thr and Tyr protein phosphatases. The enzyme's tertiary fold is highly similar to that of tyrosine-specific phosphatases, except for a "recognition" region. Length = 131
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185524 PTZ00242, PTZ00242, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|240399 PTZ00393, PTZ00393, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 211
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.94
KOG1718|consensus198 99.94
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.94
KOG1717|consensus343 99.93
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.93
KOG1716|consensus285 99.92
PTZ00393241 protein tyrosine phosphatase; Provisional 99.92
PTZ00242166 protein tyrosine phosphatase; Provisional 99.92
KOG1720|consensus225 99.89
KOG1719|consensus183 99.87
PRK12361 547 hypothetical protein; Provisional 99.87
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.79
KOG2836|consensus173 99.71
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.59
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.59
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.55
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.54
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.53
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.48
PHA02740298 protein tyrosine phosphatase; Provisional 99.47
PHA02747312 protein tyrosine phosphatase; Provisional 99.43
PHA02742303 protein tyrosine phosphatase; Provisional 99.42
PHA02738320 hypothetical protein; Provisional 99.42
PHA02746323 protein tyrosine phosphatase; Provisional 99.39
KOG0792|consensus1144 99.31
KOG0790|consensus600 99.28
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 99.26
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.16
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 99.11
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 99.09
KOG0791|consensus374 99.06
KOG2283|consensus 434 98.99
KOG4228|consensus 1087 98.97
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.86
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 98.84
KOG0793|consensus1004 98.77
KOG0789|consensus415 98.73
KOG4228|consensus1087 98.65
KOG2386|consensus 393 98.55
PLN02727 986 NAD kinase 98.54
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 98.31
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.14
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 97.98
KOG1572|consensus249 97.79
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 97.76
COG3453130 Uncharacterized protein conserved in bacteria [Fun 97.27
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 96.66
KOG4471|consensus 717 95.97
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 92.57
KOG1089|consensus 573 90.77
PLN02160136 thiosulfate sulfurtransferase 80.52
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information 
Probab=99.94  E-value=2.2e-26  Score=174.99  Aligned_cols=130  Identities=24%  Similarity=0.320  Sum_probs=114.9

Q ss_pred             cccccccccccchhhhh---hhcCceEEEEeecccccccccCCceEEEEEcCC-CCCCcHHHHHHHHHHHHHHHHcCCeE
Q psy15942         43 ILCMRKAVAFLSPAMTA---AEFNLCIARDILCMRKAEWEGRGVAHLQLDTIE-FEAPSLYAIEKGLEFIQKVAQSGGVT  118 (211)
Q Consensus        43 il~~~~~ig~~~~~~~~---~~~~i~~i~~~~~~~~~~~~~~~i~~~~~p~~D-~~~~~~~~l~~~i~~i~~~~~~~~~V  118 (211)
                      |++ ++|+|+.....+.   ++.+++.|+++...... ....+++|+++|+.| ...+..+.+..+++||+....+|++|
T Consensus         4 I~~-~l~~G~~~~~~~~~~l~~~gi~~Vi~l~~~~~~-~~~~~~~~~~ipi~D~~~~~~~~~~~~~~~~i~~~~~~~~~V   81 (138)
T smart00195        4 ILP-HLYLGSYSSALNLALLKKLGITHVINVTNEVPN-LNKKGFTYLGVPILDNTETKISPYFPEAVEFIEDAEKKGGKV   81 (138)
T ss_pred             EeC-CeEECChhHcCCHHHHHHcCCCEEEEccCCCCC-CCCCCCEEEEEECCCCCCCChHHHHHHHHHHHHHHhcCCCeE
Confidence            455 7889888777654   45799999887655432 346789999999999 67778889999999999999999999


Q ss_pred             EEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHH
Q psy15942        119 YIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYN  174 (211)
Q Consensus       119 lVHC~~G~gRS~t~~~ayLm~~~~~~~~~A~~~vr~~Rp~~~~~~~q~~~L~~~~~  174 (211)
                      +|||.+|+||||+++++|||...||++++|+++++++||.+.|+++|+++|..||+
T Consensus        82 lVHC~~G~~RS~~v~~~yl~~~~~~~~~~A~~~v~~~R~~~~p~~~~~~qL~~~e~  137 (138)
T smart00195       82 LVHCQAGVSRSATLIIAYLMKYRNLSLNDAYDFVKDRRPIISPNFGFLRQLIEYER  137 (138)
T ss_pred             EEECCCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHCCccCCCHhHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999986

>KOG1718|consensus Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG2386|consensus Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>KOG1572|consensus Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>KOG1089|consensus Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
3rgo_A157 Crystal Structure Of Ptpmt1 Length = 157 9e-16
3rgq_A156 Crystal Structure Of Ptpmt1 In Complex With Pi(5)p 1e-14
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 5e-07
1ohc_A348 Structure Of The Proline Directed Phosphatase Cdc14 7e-05
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 9e-05
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 1e-04
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 1e-04
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 1e-04
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 1e-04
4erc_A150 Structure Of Vhz Bound To Metavanadate Length = 150 3e-04
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-lik 3e-04
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 3e-04
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 5e-04
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 5e-04
2img_A151 Crystal Structure Of Dual Specificity Protein Phosp 6e-04
>pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 Back     alignment and structure 
Iteration: 1

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (60%), Gaps = 1/92 (1%)
Query: 71  LCMRKAEWEGRGVAHLQLDTIEFEA-PSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRS 129
           LC    EW+  GV  L+L T++    P+L  + KG++F  K    G   Y+HCKAGRSRS
Sbjct: 44  LCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRS 103
Query: 130 ATLTACYLIKNYNMNPDDAVKYITYKRKQIRI 161
           AT+ A YLI+ +N +P++A++ I   R  I I
Sbjct: 104 ATMVAAYLIQVHNWSPEEAIEAIAKIRSHISI 135
>pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|4ERC|A Chain A, Structure Of Vhz Bound To Metavanadate Length = 150 Back     alignment and structure
>pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
>pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query211
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 5e-28
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 2e-24
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 4e-19
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 3e-18
2oud_A177 Dual specificity protein phosphatase 10; A central 2e-17
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 3e-17
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 3e-17
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 3e-17
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 5e-17
2hcm_A164 Dual specificity protein phosphatase; structural g 6e-17
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 7e-17
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 7e-17
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 1e-16
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 1e-16
2hxp_A155 Dual specificity protein phosphatase 9; human phos 1e-16
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 2e-16
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 2e-16
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 2e-16
3emu_A161 Leucine rich repeat and phosphatase domain contain 3e-16
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 4e-16
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 4e-16
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 6e-16
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 2e-15
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 3e-15
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 8e-15
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 1e-14
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 4e-14
2q05_A195 Late protein H1, dual specificity protein phosphat 4e-14
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 7e-14
3cm3_A176 Late protein H1, dual specificity protein phosphat 1e-13
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 8e-12
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 1e-11
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 6e-08
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 8e-08
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 2e-07
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 2e-05
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 2e-07
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 1e-05
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
 Score =  102 bits (256), Expect = 5e-28
 Identities = 39/106 (36%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 71  LCMRKAEWEGRGVAHLQLDTI-EFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRS 129
           LC    EW+  GV  L+L T+     P+L  + KG++F  K    G   Y+HCKAGRSRS
Sbjct: 44  LCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRS 103

Query: 130 ATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNI 175
           AT+ A YLI+ +N +P++A++ I   R  I I  ++   + + +  
Sbjct: 104 ATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKE 149
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
3emu_A161 Leucine rich repeat and phosphatase domain contain 99.97
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 99.96
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 99.96
2hcm_A164 Dual specificity protein phosphatase; structural g 99.95
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.95
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 99.95
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.95
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.95
2oud_A177 Dual specificity protein phosphatase 10; A central 99.95
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.95
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.95
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.95
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.94
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.94
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.94
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.94
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.94
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.94
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.93
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.93
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.93
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.93
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.92
2q05_A195 Late protein H1, dual specificity protein phosphat 99.92
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.88
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.88
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.88
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.87
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.86
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.85
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.85
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.84
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.77
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.77
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.71
1xri_A151 AT1G05000; structural genomics, protein structure 99.69
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.69
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.62
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.61
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.6
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.59
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.59
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.59
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.58
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.58
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.57
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.57
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.57
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.56
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.56
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.56
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.55
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.55
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.55
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.54
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.54
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.54
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.53
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.52
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.52
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.51
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.51
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.5
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.49
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.48
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.47
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.47
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.47
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.46
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.44
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.43
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 99.43
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.41
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 99.4
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.39
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.36
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 99.36
2f46_A156 Hypothetical protein; structural genomics, joint c 99.35
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 99.33
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 99.28
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 99.26
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.23
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 98.68
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 97.38
2yf0_A512 Myotubularin-related protein 6; hydrolase; 2.65A { 92.84
1zsq_A528 Myotubularin-related protein 2; protein-phospholip 92.05
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 91.13
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=99.97  E-value=8.3e-30  Score=197.94  Aligned_cols=138  Identities=12%  Similarity=0.055  Sum_probs=118.8

Q ss_pred             cccccccccccchhhhh---hhcCceEEEEeecccccccccCCceEEEEEcCC-CCCCcHHHHHHHHHHHHHHHHcCCeE
Q psy15942         43 ILCMRKAVAFLSPAMTA---AEFNLCIARDILCMRKAEWEGRGVAHLQLDTIE-FEAPSLYAIEKGLEFIQKVAQSGGVT  118 (211)
Q Consensus        43 il~~~~~ig~~~~~~~~---~~~~i~~i~~~~~~~~~~~~~~~i~~~~~p~~D-~~~~~~~~l~~~i~~i~~~~~~~~~V  118 (211)
                      |++ ++|+|+.....+.   ++.++++|+++....+..+ ..+++|+++|+.| ...+..+.++++++||++++..|++|
T Consensus        13 I~~-~LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~~~~-~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~~~~V   90 (161)
T 3emu_A           13 IIQ-YIHLGSFLNAHNVDYIHNNNISSILLVGIEVPSLF-KDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQRKEGV   90 (161)
T ss_dssp             EET-TEEEEETTGGGCHHHHHHTTEEEEEEEC--------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHTTCEE
T ss_pred             EEC-CEEECChHHhhCHHHHHHCCCCEEEEeCCCCcccc-CCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhcCCeE
Confidence            666 7999999887655   5679999998876544433 4589999999999 66667778999999999999999999


Q ss_pred             EEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHhcCCCCC
Q psy15942        119 YIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIYGSADGS  182 (211)
Q Consensus       119 lVHC~~G~gRS~t~~~ayLm~~~~~~~~~A~~~vr~~Rp~~~~~~~q~~~L~~~~~~l~~~~~~  182 (211)
                      +|||.+|+|||+++++||||...||++++|+++||++||.+.||.+|++||..||+.|.++...
T Consensus        91 lVHC~~G~sRS~~vv~ayLm~~~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~~~~  154 (161)
T 3emu_A           91 LIISGTGVNKAPAIVIAFLMYYQRLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKMNSE  154 (161)
T ss_dssp             EEEESSSSSHHHHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHHTCC
T ss_pred             EEEcCCCCcHHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcCCCC
Confidence            9999999999999999999999999999999999999999999999999999999999876643
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 211
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 2e-15
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 2e-14
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 1e-11
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 4e-11
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 7e-11
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 3e-09
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 1e-08
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 2e-08
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 6e-08
d1xria_151 c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal 3e-05
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Proline directed phosphatase CDC14b2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 69.3 bits (169), Expect = 2e-15
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 75  KAEWEGRGVAHLQLDTIEFEAPSLYAIEKGLEFIQKVAQSGGVTYIHCKAGRSRSATLTA 134
              +   G  H  L   +   P+   ++   EF+     + G   +H KAG  R+ TL A
Sbjct: 72  AKRFTDAGFDHHDLFFADGSTPTDAIVK---EFLDICENAEGAIAVHSKAGLGRTGTLIA 128

Query: 135 CYLIKNYNMNPDDAVKYITYKRKQIRITK 163
           CY++K+Y M   + + ++   R    I  
Sbjct: 129 CYIMKHYRMTAAETIAWVRICRPGSVIGP 157
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query211
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 99.96
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.95
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.95
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.91
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.89
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.87
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.87
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.84
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.49
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.48
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.46
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.44
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.42
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.42
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.4
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.36
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.34
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.34
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.31
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.31
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.3
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 97.73
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 97.03
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 93.4
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 87.29
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=99.96  E-value=3.6e-29  Score=188.93  Aligned_cols=133  Identities=17%  Similarity=0.157  Sum_probs=117.3

Q ss_pred             cccccccccccchhhhh---hhcCceEEEEeecccccc-cccCCceEEEEEcCC-CCCCcHHHHHHHHHHHHHHHHcCCe
Q psy15942         43 ILCMRKAVAFLSPAMTA---AEFNLCIARDILCMRKAE-WEGRGVAHLQLDTIE-FEAPSLYAIEKGLEFIQKVAQSGGV  117 (211)
Q Consensus        43 il~~~~~ig~~~~~~~~---~~~~i~~i~~~~~~~~~~-~~~~~i~~~~~p~~D-~~~~~~~~l~~~i~~i~~~~~~~~~  117 (211)
                      |++ ++|+|+...+.+.   ++.++++|+++....+.. ....++.|+++|+.| +..+..+.++.+++||++++.+|++
T Consensus         7 I~p-~lylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~~~~   85 (144)
T d1mkpa_           7 ILP-FLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCG   85 (144)
T ss_dssp             EET-TEEEECTTSCCCHHHHHHTTEEEEEECCSSCCCEEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHTTCE
T ss_pred             EEC-CEEECChhHhcCHHHHHhCCCcEEEEccccCCccccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhccce
Confidence            565 7899998876655   556899998876554443 336789999999999 6777888999999999999999999


Q ss_pred             EEEEcCCCCCchHHHHHHHHHHhCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHh
Q psy15942        118 TYIHCKAGRSRSATLTACYLIKNYNMNPDDAVKYITYKRKQIRITKTEKAQIDQCYNIY  176 (211)
Q Consensus       118 VlVHC~~G~gRS~t~~~ayLm~~~~~~~~~A~~~vr~~Rp~~~~~~~q~~~L~~~~~~l  176 (211)
                      |||||.+|+|||+++++||||...|+++++|+++|+++||.+.||.+|++||.+||+.|
T Consensus        86 VlVHC~~G~~RS~~vv~aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L  144 (144)
T d1mkpa_          86 VLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL  144 (144)
T ss_dssp             EEEECSSCSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHTC
T ss_pred             EEEEecccccchHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhhC
Confidence            99999999999999999999999999999999999999999999999999999999864
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure