Diaphorina citri psyllid: psy15959


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MADSASESDSNSMDGVALMMPPSPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPHDMNNGDTASNLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHLSESESSLEMEEERHYNEIAHSMRLVGSSPSSSRPLSPGASMLTTKEPRCFACGQTTVMPIPPPVHSRPQRIKTPLLSVEQPTSPEGAPTPTLGSPMDISKS
ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
******************************************VLKVELETYKLQL********************************************************************************************************************************LVNKLWKRM*********************************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSASESDSNSMDGVALMMPPSPVTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEEFISNTLxxxxxxxxxxxxxxxxxxxxxEEFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPHDMNNGDTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxREALCRHLSESESSLEMEEERHYNEIAHSMRLVGSSPSSSRPLSPGASMLTTKEPRCFACGQTTVMPIPPPVHSRPQRIKTPLLSVEQPTSPEGAPTPTLGSPMDISKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coiled-coil domain-containing protein 6 confidentQ16204
Coiled-coil domain-containing protein 6 confidentD3YZP9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005200 [MF]structural constituent of cytoskeletonprobableGO:0003674, GO:0005198

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 85-94
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 31-62
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 63-192
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 187-208,224-256
View the alignment between query and template
View the model in PyMOL
Template: 3OJA, chain A
Confidence level:probable
Coverage over the Query: 148-216,229-278
View the alignment between query and template
View the model in PyMOL