Psyllid ID: psy15959

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---

MADSASESDSNSMDGVALMMPPSPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPHDMNNGDTASNLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHLSESESSLEMEEERHYNEIAHSMRLVGSSPSSSRPLSPGASMLTTKEPRCFACGQTTVMPIPPPVHSRPQRIKTPLLSVEQPTSPEGAPTPTLGSPMDISKS

ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

madsasesdsnsmdgvalmmppspvtREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQIkldqpvsdpssphdmnngdtasnLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHLsesesslemEEERHYNEIAhsmrlvgsspsssrplspgasmlttkeprcfacgqttvmpipppvhsrpqriktpllsveqptspegaptptlgspmdisks

madsasesdsnsmdgvaLMMPPSPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEkleaetdakqnnlEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQikldqpvsdpsspHDMNNGDTASNLSTHIHSLRSEVMRLRNQLANTqqehtekmeryvkdeknvreenlrlqrklqreverREALCrhlsesesslemEEERHYNEIAHSMRLVGSSPSSSRPLSPGASMLTTKEPRCFACGQTTVMPIPPPVHSRPQRIKTPllsveqptspegaptptlgspmdisks

MADSASESDSNSMDGVALMMPPSPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPHDMNNGDTASNLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHlsesesslemeeeRHYNEIAHsmrlvgsspsssrplspgasmLTTKEPRCFACGQTTVMPIPPPVHSRPQRIKTPLLSVEQPTSPEGAPTPTLGSPMDISKS

******************************************VLKVELETYKLQL********************************************************************************************************************************LVNKLWKRM****************************************************************************************************************************************************CFACGQTT*********************************************

*********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************

*************DGVALMMPPSPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQIKLDQ*********DMNNGDTASNLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHLS***********RHYNEIAHSMR*****************MLTTKEPRCFACGQTTVMPIPPPVHSRPQRIKTPLLSVEQPTSPEGAPTPTLGSPMDISKS

**********************SPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPH**NNGDTASNLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHLSESESSLEMEEERHYNEIAHS********************************************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MADSASESDSNSMDGVALMMPPSPVTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEEFISNTLxxxxxxxxxxxxxxxxxxxxxEEFLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPHDMNNGDTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxREALCRHLSESESSLEMEEERHYNEIAHSMRLVGSSPSSSRPLSPGASMLTTKEPRCFACGQTTVMPIPPPVHSRPQRIKTPLLSVEQPTSPEGAPTPTLGSPMDISKS

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		393	2.2.26 [Sep-21-2011]
D3YZP9		469	Coiled-coil domain-contai	yes	N/A	0.791	0.663	0.631	1e-105
Q16204		474	Coiled-coil domain-contai	yes	N/A	0.791	0.656	0.615	1e-104
Q09350		528	Uncharacterized protein T	yes	N/A	0.368	0.274	0.402	3e-17
Q54Q72		464	PH domain-containing rcdI	yes	N/A	0.315	0.267	0.450	2e-11

>sp\|D3YZP9\|CCDC6_MOUSE Coiled-coil domain-containing protein 6 OS=Mus musculus GN=Ccdc6 PE=3 SV=1	Back alignment and function desciption

 Score =  383 bits (983), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 211/334 (63%), Positives = 260/334 (77%), Gaps = 23/334 (6%)

Query: 1   MADSASESDSNSMDGVALMMPP----------------------SPVTREQLQKRIESLQ 38
           MADSASESD+++  G    M                        SP   E+L  R+ SLQ
Sbjct: 1   MADSASESDTDAAGGGPAAMQSSCSATSGGSGGGGGGKSGGIVISPFRLEELTNRLASLQ 60

Query: 39  QQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEK 98
           Q+N+VLK+ELETYKL+ +ALQEEN++LR+ SV IQA+AEQEEEFISNTL KKIQAL+KEK
Sbjct: 61  QENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEK 120

Query: 99  ETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDA 158
           ETLA +YE+EEEFLTN+LSRKL QL  EK  LEQ +EQEQE  VNKLM+KI+KLE +T +
Sbjct: 121 ETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTIS 180

Query: 159 KQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPHD 218
           KQ  LEQLRREK++LENTLEQEQEALVN+LWKRMDKLEAEKRILQ KLDQPVS P SP D
Sbjct: 181 KQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRD 240

Query: 219 MN-NGDTASNLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRK 277
           ++   D+  N+  HI  L++EV RL+ QL   Q +H+EKM +Y+++E+++REENLRLQRK
Sbjct: 241 ISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRK 300

Query: 278 LQREVERREALCRHLSESESSLEMEEERHYNEIA 311
           LQRE+ERREALCR LSESESSLEM++ER++NE++
Sbjct: 301 LQREMERREALCRQLSESESSLEMDDERYFNEMS 334

Mus musculus (taxid: 10090)

>sp\|Q16204\|CCDC6_HUMAN Coiled-coil domain-containing protein 6 OS=Homo sapiens GN=CCDC6 PE=1 SV=2	Back alignment and function description

>sp\|Q09350\|YRU4_CAEEL Uncharacterized protein T09B9.4 OS=Caenorhabditis elegans GN=T09B9.4 PE=4 SV=1	Back alignment and function description

>sp\|Q54Q72\|RDCII_DICDI PH domain-containing rcdII OS=Dictyostelium discoideum GN=rcdII PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		393
307214465		440	Coiled-coil domain-containing protein 6	0.966	0.863	0.655	1e-139
91083097		413	PREDICTED: similar to CG6664 CG6664-PA [	0.926	0.881	0.712	1e-137
340730169		425	PREDICTED: coiled-coil domain-containing	0.964	0.891	0.694	1e-134
383862828		424	PREDICTED: coiled-coil domain-containing	0.956	0.886	0.695	1e-134
66516850		425	PREDICTED: coiled-coil domain-containing	0.964	0.891	0.694	1e-133
380017928		425	PREDICTED: coiled-coil domain-containing	0.964	0.891	0.691	1e-133
307167571		434	Coiled-coil domain-containing protein 6	0.964	0.873	0.700	1e-133
380017930		406	PREDICTED: coiled-coil domain-containing	0.941	0.911	0.699	1e-132
322785456		422	hypothetical protein SINV_08651 [Solenop	0.956	0.890	0.655	1e-132
332026147		435	Coiled-coil domain-containing protein 6	0.964	0.871	0.694	1e-132

>gi\|307214465\|gb\|EFN89502.1\| Coiled-coil domain-containing protein 6 [Harpegnathos saltator]	Back alignment and taxonomy information

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 278/424 (65%), Positives = 315/424 (74%), Gaps = 44/424 (10%)

Query: 14  DGVALMMPPSPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQ 73
            G  +MMPPSPVTREQLQKRIESLQQ NRVLKVELETYKL+++ALQEEN+ LRQ SV IQ
Sbjct: 17  GGPIIMMPPSPVTREQLQKRIESLQQHNRVLKVELETYKLRVKALQEENRGLRQASVIIQ 76

Query: 74  AKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQT 133
           AKAEQEEEFISNTL+KKIQALKKEKETLAHHYEQEEE LTNDLSRKLNQL +EK RLEQT
Sbjct: 77  AKAEQEEEFISNTLLKKIQALKKEKETLAHHYEQEEECLTNDLSRKLNQLRQEKCRLEQT 136

Query: 134 IEQEQERVVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMD 193
           +EQEQE +VNKLMRKIEKLEAET AKQ+NLEQLRREKVELENTLEQEQEALVNKLWKRMD
Sbjct: 137 LEQEQECLVNKLMRKIEKLEAETLAKQSNLEQLRREKVELENTLEQEQEALVNKLWKRMD 196

Query: 194 KLEAEKRILQIKLDQPVSDPSSPHDMNNGDTASNLSTHIHSLRSEVMRLRNQLANTQQEH 253
           KLEAEKR+LQIKLDQP+SDP+SP +++NGDTA+NLSTHI +LRSEV RLR+ L  +QQEH
Sbjct: 197 KLEAEKRMLQIKLDQPISDPTSPREISNGDTATNLSTHIQTLRSEVARLRHTLLISQQEH 256

Query: 254 TEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHLSESES--------SLEMEEER 305
           TEKM+RYV +EK +REENLRLQRKLQ EVERREALCRHLSESES        SLEMEEER
Sbjct: 257 TEKMQRYVNEEKQIREENLRLQRKLQLEVERREALCRHLSESESRQLDDDFRSLEMEEER 316

Query: 306 HYNEIAHS--------MRLVGSSPSSSRPLSPGASMLTTKEP----RCFACGQTTVMP-- 351
           HYNEI  S        +        S     P +   T++E     RC+ACGQ + +P  
Sbjct: 317 HYNEIVMSGGNIRTRTVSSPVPYNPSPSSSRPLSPGSTSREGFSANRCYACGQPSALPFA 376

Query: 352 ----------IPPPVHSRPQRIKTPLL--SVEQPTSPEGAPTPTL----------GSPMD 389
                     + P       R   P +  ++  P  P     P +          GSPMD
Sbjct: 377 SSSPPSAGHIVAPSSRRTSDRFVKPAIPPTIVSPGGPPAIANPIVSAAAAAAVAAGSPMD 436

Query: 390 ISKS 393
           I+K+
Sbjct: 437 IAKT 440

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|91083097\|ref\|XP_969333.1\| PREDICTED: similar to CG6664 CG6664-PA [Tribolium castaneum] gi\|270006992\|gb\|EFA03440.1\| hypothetical protein TcasGA2_TC013430 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|340730169\|ref\|XP_003403359.1\| PREDICTED: coiled-coil domain-containing protein 6-like [Bombus terrestris] gi\|350395996\|ref\|XP_003484403.1\| PREDICTED: coiled-coil domain-containing protein 6-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|383862828\|ref\|XP_003706885.1\| PREDICTED: coiled-coil domain-containing protein 6-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|66516850\|ref\|XP_624074.1\| PREDICTED: coiled-coil domain-containing protein 6-like [Apis mellifera]	Back alignment and taxonomy information

>gi\|380017928\|ref\|XP_003692894.1\| PREDICTED: coiled-coil domain-containing protein 6-like isoform 1 [Apis florea]	Back alignment and taxonomy information

>gi\|307167571\|gb\|EFN61121.1\| Coiled-coil domain-containing protein 6 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|380017930\|ref\|XP_003692895.1\| PREDICTED: coiled-coil domain-containing protein 6-like isoform 2 [Apis florea]	Back alignment and taxonomy information

>gi\|322785456\|gb\|EFZ12127.1\| hypothetical protein SINV_08651 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|332026147\|gb\|EGI66295.1\| Coiled-coil domain-containing protein 6 [Acromyrmex echinatior]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		393
UNIPROTKB\|Q16204		474	CCDC6 "Coiled-coil domain-cont	0.735	0.609	0.651	9.1e-101
UNIPROTKB\|F1RG04		478	CCDC6 "Uncharacterized protein	0.735	0.604	0.651	6.3e-100
UNIPROTKB\|F1NQP8		479	CCDC6 "Uncharacterized protein	0.735	0.603	0.649	6.2e-98
MGI\|MGI:1923801		469	Ccdc6 "coiled-coil domain cont	0.735	0.616	0.651	4.2e-96
RGD\|1587433		470	Ccdc6 "coiled-coil domain cont	0.735	0.614	0.651	1.4e-95
ZFIN\|ZDB-GENE-040426-869		437	ccdc6b "coiled-coil domain con	0.786	0.707	0.612	1.6e-93
ZFIN\|ZDB-GENE-030131-7848		463	ccdc6a "coiled-coil domain con	0.722	0.613	0.649	3.9e-92
UNIPROTKB\|F1N091		373	LOC522998 "Uncharacterized pro	0.608	0.640	0.658	7.4e-80
WB\|WBGene00011645		528	T09B9.4 [Caenorhabditis elegan	0.666	0.496	0.295	3.1e-22
DICTYBASE\|DDB_G0284041		464	rcdII "PH domain-containing pr	0.463	0.392	0.374	4.5e-20

UNIPROTKB\|Q16204 CCDC6 "Coiled-coil domain-containing protein 6" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

 Score = 930 (332.4 bits), Expect = 9.1e-101, Sum P(3) = 9.1e-101
 Identities = 189/290 (65%), Positives = 233/290 (80%)

Query:    23 SPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEF 82
             SP   E+L  R+ SLQQ+N+VLK+ELETYKL+ +ALQEEN++LR+ SV IQA+AEQEEEF
Sbjct:    52 SPFRLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEF 111

Query:    83 ISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVV 142
             ISNTL KKIQAL+KEKETLA +YE+EEEFLTN+LSRKL QL  EK  LEQ +EQEQE  V
Sbjct:   112 ISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQV 171

Query:   143 NKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRIL 202
             NKLM+KI+KLE +T +KQ  LEQLRREK++LENTLEQEQEALVN+LWKRMDKLEAEKRIL
Sbjct:   172 NKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRIL 231

Query:   203 QIKLDQPVSDPSSPHDMNNG-DTASNLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERYV 261
             Q KLDQPVS P SP D++   D+  N+  HI  L++EV RL+ QL   Q +H+EKM +Y+
Sbjct:   232 QEKLDQPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYL 291

Query:   262 KDEKNVREENLRLQRKLQREVERREALCRHXXXXXXXXXXXXXRHYNEIA 311
             ++E+++REENLRLQRKLQRE+ERREALCR              R++NE++
Sbjct:   292 EEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMS 341

GO:0017124 "SH3 domain binding" evidence=IEA

GO:0005856 "cytoskeleton" evidence=IEA

GO:0008150 "biological_process" evidence=ND

GO:0005200 "structural constituent of cytoskeleton" evidence=TAS

GO:0005737 "cytoplasm" evidence=IDA

UNIPROTKB\|F1RG04 CCDC6 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NQP8 CCDC6 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:1923801 Ccdc6 "coiled-coil domain containing 6" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1587433 Ccdc6 "coiled-coil domain containing 6" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-869 ccdc6b "coiled-coil domain containing 6b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-7848 ccdc6a "coiled-coil domain containing 6a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N091 LOC522998 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

WB\|WBGene00011645 T09B9.4 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0284041 rcdII "PH domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q16204	CCDC6_HUMAN	No assigned EC number	0.6158	0.7913	0.6561	yes	N/A
D3YZP9	CCDC6_MOUSE	No assigned EC number	0.6317	0.7913	0.6631	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		393
pfam09755		308	pfam09755, DUF2046, Uncharacterized conserved prot	1e-119
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	3e-11
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	9e-08
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	5e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	9e-06
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	9e-06
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	9e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-05
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	3e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	5e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	5e-05
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	6e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	2e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	4e-04
TIGR04211		198	TIGR04211, SH3_and_anchor, SH3 domain protein	4e-04
TIGR01069		771	TIGR01069, mutS2, MutS2 family protein	5e-04
TIGR03319		514	TIGR03319, RNase_Y, ribonuclease Y	6e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.001
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.001
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.001
PRK00409		782	PRK00409, PRK00409, recombination and DNA strand e	0.001
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.002
PRK05771		646	PRK05771, PRK05771, V-type ATP synthase subunit I;	0.002
pfam12128		1198	pfam12128, DUF3584, Protein of unknown function (D	0.002
COG2433		652	COG2433, COG2433, Uncharacterized conserved protei	0.002
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003
pfam09787		509	pfam09787, Golgin_A5, Golgin subfamily A member 5	0.003
TIGR04211		198	TIGR04211, SH3_and_anchor, SH3 domain protein	0.004

>gnl\|CDD\|150430 pfam09755, DUF2046, Uncharacterized conserved protein H4 (DUF2046)	Back alignment and domain information

 Score =  348 bits (895), Expect = e-119
 Identities = 217/310 (70%), Positives = 261/310 (84%), Gaps = 6/310 (1%)

Query: 2   ADSASESDSNSMDGVALMMPPSPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEE 61
           A+  SESDS+     +     S  +RE+L+ RI SL+Q+N+VLK+EL+T+KL+ ++LQEE
Sbjct: 1   AECPSESDSDG----STDEGSSTASRERLRGRIHSLKQENKVLKMELDTFKLKCKSLQEE 56

Query: 62  NKNLRQTSVNIQAKAEQEEEFISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLN 121
           N+ LRQ SV+IQAKAEQEEEFISNTL+KKIQALKKEKETLA +YEQEEEFLTNDLSRKL 
Sbjct: 57  NRALRQASVSIQAKAEQEEEFISNTLLKKIQALKKEKETLAMNYEQEEEFLTNDLSRKLT 116

Query: 122 QLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQ 181
           QL +EK +LEQT+EQEQE  VNKLMRKI+KLEA+T AKQ +LEQLRREKV+LENTLEQEQ
Sbjct: 117 QLRQEKIQLEQTLEQEQEYQVNKLMRKIDKLEADTLAKQTSLEQLRREKVDLENTLEQEQ 176

Query: 182 EALVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPHDM--NNGDTASNLSTHIHSLRSEV 239
           EALVN+LWKRMDKLEAEKR+LQ KLDQPVS+P SP D+     DT   +++HI SLRSEV
Sbjct: 177 EALVNRLWKRMDKLEAEKRMLQEKLDQPVSEPPSPRDIFTEAEDTVGGIASHITSLRSEV 236

Query: 240 MRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHLSESESSL 299
            RLR  LA ++ ++TEKME+Y K+E+  REEN+RLQRKL REVERREALCR LSESESSL
Sbjct: 237 RRLRQNLAKSEADYTEKMEQYAKEERQTREENIRLQRKLLREVERREALCRQLSESESSL 296

Query: 300 EMEEERHYNE 309
           EM++ER+YNE
Sbjct: 297 EMDDERYYNE 306

This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain. Length = 308

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|234501 TIGR04211, SH3_and_anchor, SH3 domain protein	Back alignment and domain information

>gnl\|CDD\|130141 TIGR01069, mutS2, MutS2 family protein	Back alignment and domain information

>gnl\|CDD\|188306 TIGR03319, RNase_Y, ribonuclease Y	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated	Back alignment and domain information

>gnl\|CDD\|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584)	Back alignment and domain information

>gnl\|CDD\|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|220402 pfam09787, Golgin_A5, Golgin subfamily A member 5	Back alignment and domain information

>gnl\|CDD\|234501 TIGR04211, SH3_and_anchor, SH3 domain protein	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		393
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	100.0
KOG2129\|consensus		552		100.0
KOG2129\|consensus		552		99.97
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	99.96
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.69
KOG4673\|consensus		961		98.34
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.33
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.26
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	98.24
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	98.18
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.15
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.06
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.04
KOG0161\|consensus		1930		97.91
KOG0612\|consensus		1317		97.86
KOG0161\|consensus		1930		97.82
PF00038		312	Filament: Intermediate filament protein; InterPro:	97.82
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.81
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	97.79
PRK02224		880	chromosome segregation protein; Provisional	97.77
PRK11637		428	AmiB activator; Provisional	97.76
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	97.73
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	97.67
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	97.55
PRK11637		428	AmiB activator; Provisional	97.48
KOG0996\|consensus		1293		97.45
PHA02562		562	46 endonuclease subunit; Provisional	97.39
KOG4643\|consensus		1195		97.35
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	97.32
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	97.3
KOG0250\|consensus		1074		97.23
PRK03918		880	chromosome segregation protein; Provisional	97.23
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.22
KOG0612\|consensus		1317		97.21
PRK02224		880	chromosome segregation protein; Provisional	97.18
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.17
KOG0250\|consensus		1074		97.15
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	97.14
KOG1029\|consensus		1118		97.08
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	97.06
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	97.04
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	96.95
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.93
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	96.89
PRK03918		880	chromosome segregation protein; Provisional	96.88
COG4942		420	Membrane-bound metallopeptidase [Cell division and	96.82
PRK04863		1486	mukB cell division protein MukB; Provisional	96.79
KOG0971\|consensus		1243		96.73
KOG4674\|consensus		1822		96.71
KOG0971\|consensus		1243		96.71
KOG1029\|consensus		1118		96.64
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	96.63
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	96.57
PHA02562		562	46 endonuclease subunit; Provisional	96.5
KOG0977\|consensus		546		96.49
KOG0980\|consensus		980		96.47
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	96.45
KOG4674\|consensus		1822		96.3
KOG0018\|consensus		1141		96.25
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	96.23
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	96.21
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	96.12
PRK04778		569	septation ring formation regulator EzrA; Provision	96.05
KOG4643\|consensus		1195		95.96
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	95.95
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	95.93
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	95.9
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	95.8
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	95.77
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	95.76
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	95.73
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	95.52
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	95.49
PRK09039		343	hypothetical protein; Validated	95.47
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	95.42
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	95.35
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	95.31
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	95.23
PRK04863		1486	mukB cell division protein MukB; Provisional	95.21
KOG0980\|consensus		980		95.18
KOG0963\|consensus		629		95.08
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	95.07
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	94.97
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	94.94
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	94.85
PRK09039		343	hypothetical protein; Validated	94.77
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	94.7
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	94.6
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	94.56
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	94.26
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	94.18
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	94.12
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	94.06
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	94.05
PF10186		302	Atg14: UV radiation resistance protein and autopha	93.83
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	93.66
KOG0249\|consensus		916		93.63
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	93.54
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	93.39
KOG0804\|consensus		493		93.36
KOG0962\|consensus		1294		93.24
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	93.14
KOG1924\|consensus		1102		93.03
KOG0964\|consensus		1200		93.01
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	93.0
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	92.9
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	92.9
KOG0977\|consensus		546		92.78
PRK11281		1113	hypothetical protein; Provisional	92.74
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	92.73
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	92.56
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	92.54
KOG4593\|consensus		716		92.51
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	92.37
KOG0996\|consensus		1293		92.28
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	92.26
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	92.08
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	92.07
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	91.99
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	91.77
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	91.68
KOG0933\|consensus		1174		91.46
KOG0978\|consensus		698		91.41
PRK11820		288	hypothetical protein; Provisional	91.28
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	91.1
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	91.04
KOG2072\|consensus		988		90.97
smart00502		127	BBC B-Box C-terminal domain. Coiled coil region C-	90.93
TIGR00255		291	conserved hypothetical protein TIGR00255. The appa	90.85
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	90.57
PRK10929		1109	putative mechanosensitive channel protein; Provisi	90.47
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	90.36
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	90.21
PF06120		301	Phage_HK97_TLTM: Tail length tape measure protein;	90.14
PF07058		351	Myosin_HC-like: Myosin II heavy chain-like; InterP	90.11
PF15035		182	Rootletin: Ciliary rootlet component, centrosome c	90.07
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	90.04
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	89.96
KOG0288\|consensus		459		89.94
KOG0976\|consensus		1265		89.66
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	89.52
PF10186		302	Atg14: UV radiation resistance protein and autopha	89.33
KOG4593\|consensus		716		89.31
PRK01156		895	chromosome segregation protein; Provisional	89.26
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	89.23
PRK01156		895	chromosome segregation protein; Provisional	89.08
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	89.03
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	88.97
KOG1924\|consensus		1102		88.79
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	88.38
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	88.34
COG2433		652	Uncharacterized conserved protein [Function unknow	88.29
KOG1265\|consensus		1189		87.73
PF14988		206	DUF4515: Domain of unknown function (DUF4515)	87.53
PF06156		107	DUF972: Protein of unknown function (DUF972); Inte	87.31
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	87.22
PRK15422		79	septal ring assembly protein ZapB; Provisional	87.2
KOG4673\|consensus		961		86.95
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	86.71
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	86.38
KOG2751\|consensus		447		85.86
KOG0978\|consensus		698		85.67
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	85.54
KOG4807\|consensus		593		85.44
PRK15178		434	Vi polysaccharide export inner membrane protein Ve	85.41
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	85.06
PRK13169		110	DNA replication intiation control protein YabA; Re	85.04
KOG1853\|consensus		333		84.89
TIGR03752		472	conj_TIGR03752 integrating conjugative element pro	84.77
KOG1850\|consensus		391		84.62
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	84.61
KOG1899\|consensus		861		84.22
PF12711		86	Kinesin-relat_1: Kinesin motor; InterPro: IPR02465	83.88
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	83.85
KOG0963\|consensus		629		83.75
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	83.7
PF09744		158	Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte	83.59
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	83.56
KOG4360\|consensus		596		83.46
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	82.93
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	82.88
KOG4302\|consensus		660		82.5
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	82.48
PRK10884		206	SH3 domain-containing protein; Provisional	82.29
KOG0239\|consensus		670		82.22
COG2433		652	Uncharacterized conserved protein [Function unknow	81.85
PF10211		189	Ax_dynein_light: Axonemal dynein light chain; Inte	81.82
PF10211		189	Ax_dynein_light: Axonemal dynein light chain; Inte	81.79
COG4026		290	Uncharacterized protein containing TOPRIM domain,	81.54
PRK11519		719	tyrosine kinase; Provisional	81.16
PF08172		248	CASP_C: CASP C terminal; InterPro: IPR012955 This	81.16
PLN03188		1320	kinesin-12 family protein; Provisional	80.98
KOG0804\|consensus		493		80.9
KOG0946\|consensus		970		80.87
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	80.71
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	80.62
KOG0243\|consensus		1041		80.48
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	80.08

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

Probab=100.00  E-value=1.2e-96  Score=710.60  Aligned_cols=305  Identities=73%  Similarity=0.976  Sum_probs=297.8

Q ss_pred             CCCccccccccccCccccCCCCcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHH
Q psy15959          2 ADSASESDSNSMDGVALMMPPSPVTREQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEE   81 (393)
Q Consensus         2 ~ds~sesd~ss~~g~~~~~p~s~~~~e~~~~ri~sLqqenr~lk~ele~~k~R~k~LqeEnr~LR~~sv~iq~kaEqEEE   81 (393)
                      |||+||||+   ||+. |+|+|++|+++++.++++|+++|++||.++++++.|+++|+++|+.||.++|.|+++||||||
T Consensus         1 ~~s~sesd~---d~~~-~~~~S~~t~~~l~~~~~sL~qen~~Lk~El~~ek~~~~~L~~e~~~lr~~sv~~~~~aEqEEE   76 (310)
T PF09755_consen    1 ADSASESDT---DGAG-MTSSSSATREQLRKRIESLQQENRVLKRELETEKARCKHLQEENRALREASVRIQAKAEQEEE   76 (310)
T ss_pred             CCccccccc---cCCC-CCCCCCCchHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            689999874   4543 678999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q psy15959         82 FISNTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIEQEQERVVNKLMRKIEKLEAETDAKQN  161 (393)
Q Consensus        82 fItNtL~KKL~~LkkEKe~L~~~~EqEEE~LTN~L~KKL~qL~~EKv~LE~~LEqEQE~lVNkL~KkiekLeaEk~~~q~  161 (393)
                      ||||+|+|||++|+++|++|+++||+|||||||+|+|||.+|++||++||++|++||||+||+|+++|++|++++.+++.
T Consensus        77 ~isN~LlKkl~~l~keKe~L~~~~e~EEE~ltn~L~rkl~qLr~EK~~lE~~Le~EqE~~V~kL~k~i~~Le~e~~~~q~  156 (310)
T PF09755_consen   77 FISNTLLKKLQQLKKEKETLALKYEQEEEFLTNDLSRKLNQLRQEKVELENQLEQEQEYLVNKLQKKIERLEKEKSAKQE  156 (310)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHhHhHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCC----CCCCccchhHhHHHHHH
Q psy15959        162 NLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKRILQIKLDQPVSDPSSPHDMN----NGDTASNLSTHIHSLRS  237 (393)
Q Consensus       162 ~L~qLrrEKVeLEn~LEqEQE~LVNkLqKrmdkLe~EKr~LQ~~Leq~vS~~~SP~~~~----~~dt~~~l~~~i~~Lr~  237 (393)
                      .|++|++|||+|||+||+|||+|||||||||++|+++||.||.+|++|+|+|+||+|++    ++||++++++||..||.
T Consensus       157 ~le~Lr~EKVdlEn~LE~EQE~lvN~L~Kqm~~l~~eKr~Lq~~l~~~~s~~~s~~d~~~~~~~~Dt~e~~~shI~~Lr~  236 (310)
T PF09755_consen  157 ELERLRREKVDLENTLEQEQEALVNRLWKQMDKLEAEKRRLQEKLEQPVSAPPSPRDTVNVSEENDTAERLSSHIRSLRQ  236 (310)
T ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccCCCCCcchHHhhcccCCchhHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999975    58899999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhHHHHhHHHHHhHHHHHHHHHHHHHHHHHHHhhhhcccchhhhhhhccHHH
Q psy15959        238 EVMRLRNQLANTQQEHTEKMERYVKDEKNVREENLRLQRKLQREVERREALCRHLSESESSLEMEEERHYNEI  310 (393)
Q Consensus       238 Ev~~Lr~~l~~~q~e~~~k~~~~~~ee~~~reeN~rl~~kl~~E~erreal~r~lsesesslE~~eer~fn~~  310 (393)
                      ||++||++|..+++++.+||.+|+.++++||+||+|||++|++|+|||+|||||||+||||||||||||||++
T Consensus       237 EV~RLR~qL~~sq~e~~~k~~~~~~eek~ireEN~rLqr~L~~E~erreal~R~lsesEsslE~ddEr~fne~  309 (310)
T PF09755_consen  237 EVSRLRQQLAASQQEHSEKMAQYLQEEKEIREENRRLQRKLQREVERREALCRHLSESESSLEMDDERQFNEM  309 (310)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcchHhhhccc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999986

>KOG2129\|consensus	Back alignment and domain information

>KOG2129\|consensus	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG4673\|consensus	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0161\|consensus	Back alignment and domain information

>KOG0612\|consensus	Back alignment and domain information

>KOG0161\|consensus	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>KOG0996\|consensus	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG4643\|consensus	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>KOG0250\|consensus	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0612\|consensus	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>KOG0250\|consensus	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG1029\|consensus	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0971\|consensus	Back alignment and domain information

>KOG4674\|consensus	Back alignment and domain information

>KOG0971\|consensus	Back alignment and domain information

>KOG1029\|consensus	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0977\|consensus	Back alignment and domain information

>KOG0980\|consensus	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>KOG4674\|consensus	Back alignment and domain information

>KOG0018\|consensus	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG4643\|consensus	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0980\|consensus	Back alignment and domain information

>KOG0963\|consensus	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>KOG0249\|consensus	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG0804\|consensus	Back alignment and domain information

>KOG0962\|consensus	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG1924\|consensus	Back alignment and domain information

>KOG0964\|consensus	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>KOG0977\|consensus	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>KOG4593\|consensus	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG0996\|consensus	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>KOG0933\|consensus	Back alignment and domain information

>KOG0978\|consensus	Back alignment and domain information

>PRK11820 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG2072\|consensus	Back alignment and domain information

>smart00502 BBC B-Box C-terminal domain	Back alignment and domain information

>TIGR00255 conserved hypothetical protein TIGR00255	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12)	Back alignment and domain information

>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana	Back alignment and domain information

>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG0288\|consensus	Back alignment and domain information

>KOG0976\|consensus	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>KOG4593\|consensus	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>KOG1924\|consensus	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1265\|consensus	Back alignment and domain information

>PF14988 DUF4515: Domain of unknown function (DUF4515)	Back alignment and domain information

>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>PRK15422 septal ring assembly protein ZapB; Provisional	Back alignment and domain information

>KOG4673\|consensus	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG2751\|consensus	Back alignment and domain information

>KOG0978\|consensus	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG4807\|consensus	Back alignment and domain information

>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PRK13169 DNA replication intiation control protein YabA; Reviewed	Back alignment and domain information

>KOG1853\|consensus	Back alignment and domain information

>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family	Back alignment and domain information

>KOG1850\|consensus	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>KOG1899\|consensus	Back alignment and domain information

>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>KOG0963\|consensus	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG4360\|consensus	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG4302\|consensus	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>KOG0239\|consensus	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility	Back alignment and domain information

>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG0804\|consensus	Back alignment and domain information

>KOG0946\|consensus	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>KOG0243\|consensus	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		393
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	4e-19
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	5e-15
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-13
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-11
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	5e-06
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	7e-15
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	6e-12
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	4e-11
2ycu_A		995	Non muscle myosin 2C, alpha-actinin; motor protein	4e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-07
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	1e-08
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	1e-05
1m1j_C		409	Fibrinogen gamma chain; coiled coils, disulfide ri	2e-04

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

 Score = 88.4 bits (219), Expect = 4e-19
 Identities = 50/286 (17%), Positives = 119/286 (41%), Gaps = 30/286 (10%)

Query: 27   REQLQKRIESLQQQNRVLKVELETYKLQLRALQEENKNLRQTSVNIQAKAEQEEEFISNT 86
            R +L  + + L++    ++  +E  + + + LQ E K ++Q  ++++ + E+EE      
Sbjct: 915  RVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDLEEQLEEEE------ 968

Query: 87   LMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIE------QEQER 140
                 Q L+ EK T     ++ E+ +   +  + N+LT+E+  LE+ +        E+E 
Sbjct: 969  --AARQKLQLEKVTADGKIKKMEDDILI-MEDQNNKLTKERKLLEERVSDLTTNLAEEEE 1025

Query: 141  VVNKLMRKIEKLEAETDAKQNNLEQLRREKVELENTLEQEQEALVNKLWKRMDKLEAEKR 200
                L +   K E+     +  L++  + + ELE    ++ E   + L +++ +L+A+  
Sbjct: 1026 KAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIK-RKLEGESSDLHEQIAELQAQIA 1084

Query: 201  ILQIKLDQPVSDPSSPHDMNNGDTASNLSTHIHSLRSEVMRLRNQLANTQQEHTEKMERY 260
             L+ +L +   +                   +    S+      ++   +      ++  
Sbjct: 1085 ELKAQLAKKEEE------------LQAALARLEDETSQKNNALKKIRELESHI-SDLQED 1131

Query: 261  VKDEKNVREENLRLQRKLQREVER-REALCRHLSESESSLEMEEER 305
            ++ EK  R +  + +R L  E+E  +  L   L  + +  E+    
Sbjct: 1132 LESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSD 1177

PyMOL of 1i84

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010	Back alignment and structure

>1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		393
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	97.93
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	97.89
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	97.63
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	97.55
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	97.48
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	97.39
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	96.81
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	96.55
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	96.5
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	96.48
2v71_A		189	Nuclear distribution protein NUDE-like 1; developm	96.01
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	95.89
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	95.42
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	95.4
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	95.08
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	94.91
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	94.87
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	94.65
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	94.38
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	94.23
3q8t_A		96	Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90	91.61
1deb_A		54	APC protein, adenomatous polyposis coli protein; c	91.32
1go4_E		100	MAD1 (mitotic arrest deficient)-like 1; mitotic sp	90.94
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	90.23
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	89.99
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	89.98
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	89.79
2v66_B		111	Nuclear distribution protein NUDE-like 1; structur	89.22
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	89.18
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	88.82
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	88.43
3ghg_A		562	Fibrinogen alpha chain; triple-stranded coiled coi	87.63
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	86.43
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	85.45
1s1c_X		71	RHO-associated, coiled-coil containing protein kin	84.15
4emc_A		190	Monopolin complex subunit CSM1; RWD domain, kineto	84.04
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	83.62
3bas_A		89	Myosin heavy chain, striated muscle/general contro	82.97
2jee_A		81	YIIU; FTSZ, septum, coiled-coil, cell division, ce	82.79
3s4r_A		93	Vimentin; alpha-helix, cytoskeleton, intermediate	82.61
3swk_A		86	Vimentin; cytoskeleton, intermediate filament, alp	82.52
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	81.41
1go4_E		100	MAD1 (mitotic arrest deficient)-like 1; mitotic sp	80.89
2zxx_A		79	Geminin; coiled-coil, cell cycle, coiled coil, DNA	80.65
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	80.34
3s4r_A		93	Vimentin; alpha-helix, cytoskeleton, intermediate	80.26

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

Probab=97.93  E-value=3e-05  Score=84.57  Aligned_cols=50  Identities=24%  Similarity=0.306  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhHHHHHHHHhHH
Q psy15959         85 NTLMKKIQALKKEKETLAHHYEQEEEFLTNDLSRKLNQLTEEKYRLEQTIE  135 (393)
Q Consensus        85 NtL~KKL~~LkkEKe~L~~~~EqEEE~LTN~L~KKL~qL~~EKv~LE~~LE  135 (393)
                      ..|..++.+|..+...+..+++.+++-+ +.|..++.++..+...|+..++
T Consensus       916 ~~l~~~~~~Le~~l~ele~elee~ee~l-~el~~e~~~le~el~~L~~ele  965 (1184)
T 1i84_S          916 VRLAAKKQELEEILHEMEARIEEEEERS-QQLQAEKKKMQQQMLDLEEQLE  965 (1184)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHC------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHH
Confidence            4455555566665555655554443332 2334444444444444444443

PyMOL of 1i84

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus}	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens}	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus}	Back alignment and structure

>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1	Back alignment and structure

>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens}	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>1s1c_X RHO-associated, coiled-coil containing protein kinase 1; GTPase, RHO kinase, ROCK, signaling protein; HET: GNP; 2.60A {Homo sapiens} SCOP: h.1.27.1	Back alignment and structure

>4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A	Back alignment and structure

>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli}	Back alignment and structure

>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A	Back alignment and structure

>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens}	Back alignment and structure

>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1	Back alignment and structure

>2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus}	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		393
d2ap3a1		185	Hypothetical protein MW0975 (SA0943) {Staphylococc	81.56

>d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: MW0975(SA0943)-like
family: MW0975(SA0943)-like
domain: Hypothetical protein MW0975 (SA0943)
species: Staphylococcus aureus [TaxId: 1280]

Probab=81.56  E-value=7.6  Score=28.08  Aligned_cols=20  Identities=25%  Similarity=0.350  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy15959        182 EALVNKLWKRMDKLEAEKRI  201 (393)
Q Consensus       182 E~LVNkLqKrmdkLe~EKr~  201 (393)
                      +..+..+.+.+.++..++..
T Consensus       164 ~~~~~~~~~~~~~~~~ek~~  183 (185)
T d2ap3a1         164 KEVSDKYTKVLNKVQKEKQD  183 (185)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhhh
Confidence            33445555666666666544

PyMOL of d2ap3a1