Diaphorina citri psyllid: psy15960


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MKEWWGKIRKKEEEKEGDEEVKRVGARRRIRMRDLIQRAKVEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN
ccccccccccHHcccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEccccHHHHHHHHcccccccccEEEccccccccccHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHcccEEEEEEcc
**EWWGKIRKKEEEKEGDEEVKRVGARRRIRMRDLIQRAKVEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEWWGKIRKKEEEKEGDEEVKRVGARRRIRMRDLIQRAKVEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-hydroxyacyl-CoA lyase 1 Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.confidentQ9QXE0
2-hydroxyacyl-CoA lyase 1 Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.confidentQ8CHM7
Putative 2-hydroxyacyl-CoA lyase Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.confidentP39994

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:1901363 [MF]heterocyclic compound bindingprobableGO:0003674, GO:0005488
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0097159 [MF]organic cyclic compound bindingprobableGO:0003674, GO:0005488
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0048037 [MF]cofactor bindingprobableGO:0003674, GO:0005488
GO:0036094 [MF]small molecule bindingprobableGO:0003674, GO:0005488
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C31, chain A
Confidence level:very confident
Coverage over the Query: 67-177
View the alignment between query and template
View the model in PyMOL
Template: 2WVG, chain A
Confidence level:very confident
Coverage over the Query: 17-177
View the alignment between query and template
View the model in PyMOL