Psyllid ID: psy15960

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MKEWWGKIRKKEEEKEGDEEVKRVGARRRIRMRDLIQRAKVEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN
cccccccccHHHHccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEcccHHHHHHHHHcccccccccEEEccccccccccHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHcccEEEEEEcc
ccccccccccHHccccccccccEcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHccccccEEEEEEcccHHHHcHHHHHHHHHccccEEEEEEcc
mkewwgkirkkeeekegDEEVKRVGARRRIRMRDLIQRAKVeegemkvggnmrgvDSAVEKMIqdesvplnYYAAIHAVQvsipdnciivgegantmDIGRSLLLnnlprhrldagtfgtmGVGLGFALAAALYcnhyapgkrvvcvqgdsafgfsgmELETLVRYRLPVILVILYN
mkewwgkirkkeeekegdeevkrvgarrrirmrdliqrakveegemkvggnmrgVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMeletlvryrlPVILVILYN
MkewwgkirkkeeekegdeevkrvGArrrirmrdliqrAKVEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMgvglgfalaaalYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN
************************************************************KMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILY*
**EWWGKIRKKEEEKEGDEEVKRVGARRRIRMRDLIQRAKVEEGEMKVGGNMRGVDSAVEKMI***SVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN
MKEWWGKIRKK************VGARRRIRMRDLIQRAKVEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN
***WWGKIRKKEEEKEGDEEVKRVGARRRIRMRDLIQRAKVEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEWWGKIRKKEEEKEGDEEVKRVGARRRIRMRDLIQRAKVEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q8CHM7581 2-hydroxyacyl-CoA lyase 1 yes N/A 0.706 0.215 0.603 8e-41
Q9UJ83578 2-hydroxyacyl-CoA lyase 1 yes N/A 0.711 0.217 0.571 9e-41
Q9QXE0581 2-hydroxyacyl-CoA lyase 1 yes N/A 0.711 0.216 0.579 3e-40
Q54DA9580 Probable 2-hydroxyacyl-Co yes N/A 0.587 0.179 0.518 3e-26
Q9LF46572 2-hydroxyacyl-CoA lyase O yes N/A 0.632 0.195 0.492 2e-25
P0AFI0564 Probable oxalyl-CoA decar N/A N/A 0.632 0.198 0.475 4e-23
P0AFI1564 Probable oxalyl-CoA decar N/A N/A 0.632 0.198 0.475 4e-23
P39994560 Putative 2-hydroxyacyl-Co yes N/A 0.587 0.185 0.504 5e-21
Q9Y7M1568 Putative 2-hydroxyacyl-Co yes N/A 0.621 0.193 0.438 3e-20
P40149568 Oxalyl-CoA decarboxylase N/A N/A 0.706 0.220 0.412 4e-20
>sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 Back     alignment and function desciption
 Score =  166 bits (420), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 99/126 (78%), Gaps = 1/126 (0%)

Query: 53  RGVDSAVEK-MIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRH 111
           R  + AV K +   +S+P+NYY   + VQ  +P NC IV EGANTMDIGR++L N LPRH
Sbjct: 360 RKNNEAVSKELASKKSLPMNYYTVFYHVQEQLPRNCFIVSEGANTMDIGRTVLQNYLPRH 419

Query: 112 RLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVI 171
           RLDAG+FGTMGVGLGFA+AAA+     +PG+RV+CV+GDSAFGFSGME+ET+ RY LP+I
Sbjct: 420 RLDAGSFGTMGVGLGFAIAAAVVAKERSPGQRVICVEGDSAFGFSGMEVETICRYNLPII 479

Query: 172 LVILYN 177
           ++++ N
Sbjct: 480 ILVVNN 485
Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Rattus norvegicus (taxid: 10116)
EC: 4EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 Back     alignment and function description
>sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=2 SV=1 Back     alignment and function description
>sp|P0AFI0|OXC_ECOLI Probable oxalyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=oxc PE=1 SV=1 Back     alignment and function description
>sp|P0AFI1|OXC_ECO57 Probable oxalyl-CoA decarboxylase OS=Escherichia coli O157:H7 GN=oxc PE=3 SV=1 Back     alignment and function description
>sp|P39994|YEC0_YEAST Putative 2-hydroxyacyl-CoA lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEL020C PE=1 SV=1 Back     alignment and function description
>sp|Q9Y7M1|YGK4_SCHPO Putative 2-hydroxyacyl-CoA lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.04 PE=3 SV=1 Back     alignment and function description
>sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
193586967 571 PREDICTED: 2-hydroxyacyl-CoA lyase 1-lik 0.672 0.208 0.697 2e-46
91088717 568 PREDICTED: similar to 2-hydroxyphytanoyl 0.672 0.209 0.714 1e-45
195431708 574 GK15680 [Drosophila willistoni] gi|19415 0.672 0.207 0.697 1e-43
332028930 312 2-hydroxyacyl-CoA lyase 1 [Acromyrmex ec 0.638 0.362 0.716 1e-43
194881517 568 GG20879 [Drosophila erecta] gi|190658064 0.672 0.209 0.689 3e-43
195585025 540 GD25296 [Drosophila simulans] gi|1941943 0.672 0.220 0.689 3e-43
125811586 568 GA10842 [Drosophila pseudoobscura pseudo 0.677 0.211 0.683 4e-43
195170154 568 GL10162 [Drosophila persimilis] gi|19411 0.677 0.211 0.683 4e-43
357618628 568 2-hydroxyphytanoyl-CoA lyase [Danaus ple 0.672 0.209 0.697 4e-43
19922626 568 CG11208 [Drosophila melanogaster] gi|730 0.672 0.209 0.689 4e-43
>gi|193586967|ref|XP_001952174.1| PREDICTED: 2-hydroxyacyl-CoA lyase 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 83/119 (69%), Positives = 104/119 (87%)

Query: 59  VEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTF 118
           VE M++D S+PLNYY     V  +IP +C+IV EGANTMDIGR++LLNNLPRHRLDAGTF
Sbjct: 357 VESMMKDTSIPLNYYTVFRHVSDNIPKDCMIVSEGANTMDIGRAVLLNNLPRHRLDAGTF 416

Query: 119 GTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN 177
           GTMGVGLGFA+AAAL+C  Y PGKRV+CV+GDSAFGFSGME+ET+VRY+LP++++++ N
Sbjct: 417 GTMGVGLGFAIAAALWCQKYEPGKRVLCVEGDSAFGFSGMEVETMVRYKLPIVIIVVNN 475

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91088717|ref|XP_975143.1| PREDICTED: similar to 2-hydroxyphytanoyl-coa lyase [Tribolium castaneum] gi|270011662|gb|EFA08110.1| hypothetical protein TcasGA2_TC005714 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195431708|ref|XP_002063870.1| GK15680 [Drosophila willistoni] gi|194159955|gb|EDW74856.1| GK15680 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|332028930|gb|EGI68948.1| 2-hydroxyacyl-CoA lyase 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|194881517|ref|XP_001974877.1| GG20879 [Drosophila erecta] gi|190658064|gb|EDV55277.1| GG20879 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195585025|ref|XP_002082295.1| GD25296 [Drosophila simulans] gi|194194304|gb|EDX07880.1| GD25296 [Drosophila simulans] Back     alignment and taxonomy information
>gi|125811586|ref|XP_001361932.1| GA10842 [Drosophila pseudoobscura pseudoobscura] gi|54637108|gb|EAL26511.1| GA10842 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195170154|ref|XP_002025878.1| GL10162 [Drosophila persimilis] gi|194110742|gb|EDW32785.1| GL10162 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|357618628|gb|EHJ71538.1| 2-hydroxyphytanoyl-CoA lyase [Danaus plexippus] Back     alignment and taxonomy information
>gi|19922626|ref|NP_611460.1| CG11208 [Drosophila melanogaster] gi|7302414|gb|AAF57501.1| CG11208 [Drosophila melanogaster] gi|16198201|gb|AAL13912.1| LD40177p [Drosophila melanogaster] gi|220946180|gb|ACL85633.1| CG11208-PA [synthetic construct] gi|220955878|gb|ACL90482.1| CG11208-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
FB|FBgn0034488568 CG11208 [Drosophila melanogast 0.672 0.209 0.605 2.1e-35
UNIPROTKB|I3LUX2302 HACL1 "Uncharacterized protein 0.711 0.417 0.5 3.7e-32
UNIPROTKB|E2R9K1581 HACL1 "Uncharacterized protein 0.711 0.216 0.5 6.9e-32
UNIPROTKB|B3KPX4337 HACL1 "cDNA FLJ32415 fis, clon 0.711 0.373 0.492 1.3e-31
UNIPROTKB|B4DXI5496 HACL1 "2-hydroxyacyl-CoA lyase 0.711 0.254 0.492 1.3e-31
RGD|619849581 Hacl1 "2-hydroxyacyl-CoA lyase 0.689 0.209 0.528 1.5e-31
UNIPROTKB|J9NS82 763 HACL1 "Uncharacterized protein 0.711 0.165 0.5 1.9e-31
UNIPROTKB|B4DWI1551 HACL1 "cDNA FLJ53672, highly s 0.711 0.228 0.492 3e-31
UNIPROTKB|E9PEN4518 HACL1 "2-hydroxyacyl-CoA lyase 0.711 0.243 0.492 4e-31
UNIPROTKB|Q9UJ83578 HACL1 "2-hydroxyacyl-CoA lyase 0.711 0.217 0.492 4e-31
FB|FBgn0034488 CG11208 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 384 (140.2 bits), Expect = 2.1e-35, P = 2.1e-35
 Identities = 72/119 (60%), Positives = 88/119 (73%)

Query:    59 VEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTF 118
             V+KM  +   PLNYYA  H ++  +P + IIV EGANTMDIGRS+LLN  PRHRLDAGTF
Sbjct:   354 VQKMSLNTETPLNYYAVFHHLRELLPKDTIIVSEGANTMDIGRSMLLNEQPRHRLDAGTF 413

Query:   119 GTMXXXXXXXXXXXXYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN 177
             GTM            +C  +APGKRV+CV+GDSAFGFSGME+ET+VRY+LPV +VI+ N
Sbjct:   414 GTMGVGPGFAVAAALFCRDFAPGKRVLCVEGDSAFGFSGMEIETMVRYKLPVTIVIVNN 472
GO:0008949 "oxalyl-CoA decarboxylase activity" evidence=ISS
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0030976 "thiamine pyrophosphate binding" evidence=IEA
UNIPROTKB|I3LUX2 HACL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9K1 HACL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B3KPX4 HACL1 "cDNA FLJ32415 fis, clone SKMUS2000724, highly similar to 2-hydroxyphytanoyl-CoA lyase (EC 4.1.-.-)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DXI5 HACL1 "2-hydroxyacyl-CoA lyase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|619849 Hacl1 "2-hydroxyacyl-CoA lyase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS82 HACL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DWI1 HACL1 "cDNA FLJ53672, highly similar to 2-hydroxyphytanoyl-CoA lyase (EC 4.1.-.-)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PEN4 HACL1 "2-hydroxyacyl-CoA lyase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJ83 HACL1 "2-hydroxyacyl-CoA lyase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P39994YEC0_YEAST4, ., 1, ., -, ., -0.50450.58750.1857yesN/A
Q9QXE0HACL1_MOUSE4, ., 1, ., -, ., -0.57930.71180.2168yesN/A
Q54DA9HACL1_DICDI4, ., 1, ., -, ., -0.51810.58750.1793yesN/A
Q8CHM7HACL1_RAT4, ., 1, ., -, ., -0.60310.70620.2151yesN/A
Q9UJ83HACL1_HUMAN4, ., 1, ., -, ., -0.57140.71180.2179yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
cd02004172 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate 3e-56
PRK09259569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 3e-40
TIGR03254554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 3e-36
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 9e-26
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 9e-22
pfam02775151 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate en 4e-21
PRK05858542 PRK05858, PRK05858, hypothetical protein; Provisio 1e-17
cd02015186 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) fa 1e-16
cd02014178 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) fam 6e-16
cd02010177 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) fam 7e-14
PRK07525588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 8e-14
cd02013196 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP 7e-13
PRK08617552 PRK08617, PRK08617, acetolactate synthase; Reviewe 8e-13
PRK06154565 PRK06154, PRK06154, hypothetical protein; Provisio 1e-12
TIGR02418539 TIGR02418, acolac_catab, acetolactate synthase, ca 6e-12
PRK08155564 PRK08155, PRK08155, acetolactate synthase catalyti 4e-11
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa 8e-11
TIGR03457579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 1e-10
PRK06112578 PRK06112, PRK06112, acetolactate synthase catalyti 3e-10
PRK07586514 PRK07586, PRK07586, hypothetical protein; Validate 6e-10
PRK07418 616 PRK07418, PRK07418, acetolactate synthase 3 cataly 1e-09
TIGR00118558 TIGR00118, acolac_lg, acetolactate synthase, large 2e-09
PRK08978548 PRK08978, PRK08978, acetolactate synthase 2 cataly 3e-09
PRK08266542 PRK08266, PRK08266, hypothetical protein; Provisio 4e-09
PRK07979574 PRK07979, PRK07979, acetolactate synthase 3 cataly 4e-09
PRK08611 576 PRK08611, PRK08611, pyruvate oxidase; Provisional 5e-09
PRK08322547 PRK08322, PRK08322, acetolactate synthase; Reviewe 5e-09
PRK06276 586 PRK06276, PRK06276, acetolactate synthase catalyti 6e-09
PRK08199557 PRK08199, PRK08199, thiamine pyrophosphate protein 6e-09
cd02005183 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP 1e-08
PRK07092530 PRK07092, PRK07092, benzoylformate decarboxylase; 1e-08
PRK06882574 PRK06882, PRK06882, acetolactate synthase 3 cataly 1e-08
PRK08527563 PRK08527, PRK08527, acetolactate synthase 3 cataly 2e-08
PRK06466574 PRK06466, PRK06466, acetolactate synthase 3 cataly 3e-08
TIGR02720 575 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase 3e-08
CHL00099 585 CHL00099, ilvB, acetohydroxyacid synthase large su 5e-08
PRK06048561 PRK06048, PRK06048, acetolactate synthase 3 cataly 5e-07
PRK06725570 PRK06725, PRK06725, acetolactate synthase 3 cataly 6e-07
PRK07524535 PRK07524, PRK07524, hypothetical protein; Provisio 7e-07
PRK06456572 PRK06456, PRK06456, acetolactate synthase catalyti 8e-07
PRK08979572 PRK08979, PRK08979, acetolactate synthase 3 cataly 8e-07
cd02008178 cd02008, TPP_IOR_alpha, Thiamine pyrophosphate (TP 2e-06
PRK06965587 PRK06965, PRK06965, acetolactate synthase 3 cataly 3e-06
PRK12474518 PRK12474, PRK12474, hypothetical protein; Provisio 3e-06
PLN02470 585 PLN02470, PLN02470, acetolactate synthase 4e-06
PRK09107 595 PRK09107, PRK09107, acetolactate synthase 3 cataly 1e-05
PRK06457549 PRK06457, PRK06457, pyruvate dehydrogenase; Provis 6e-05
PRK07710571 PRK07710, PRK07710, acetolactate synthase catalyti 1e-04
TIGR03297361 TIGR03297, Ppyr-DeCO2ase, phosphonopyruvate decarb 2e-04
PRK07282566 PRK07282, PRK07282, acetolactate synthase catalyti 3e-04
COG4231 640 COG4231, COG4231, Indolepyruvate ferredoxin oxidor 3e-04
COG3961557 COG3961, COG3961, Pyruvate decarboxylase and relat 6e-04
COG3960 592 COG3960, COG3960, Glyoxylate carboligase [General 8e-04
PRK08273 597 PRK08273, PRK08273, thiamine pyrophosphate protein 0.001
PRK06546 578 PRK06546, PRK06546, pyruvate dehydrogenase; Provis 0.001
pfam14352129 pfam14352, DUF4402, Domain of unknown function (DU 0.001
PRK08327569 PRK08327, PRK08327, acetolactate synthase catalyti 0.002
cd02006202 cd02006, TPP_Gcl, Thiamine pyrophosphate (TPP) fam 0.002
PRK11269 591 PRK11269, PRK11269, glyoxylate carboligase; Provis 0.002
TIGR01504 588 TIGR01504, glyox_carbo_lig, glyoxylate carboligase 0.003
>gnl|CDD|238962 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information 
 Score =  174 bits (443), Expect = 3e-56
 Identities = 63/106 (59%), Positives = 78/106 (73%), Gaps = 4/106 (3%)

Query: 72  YYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAA 131
            Y  +H +Q ++PD+ IIV +G NTMD  R +L    PRHRLDAGTFGT+GVGLG+A+AA
Sbjct: 1   PYRVLHELQEALPDDAIIVSDGGNTMDWARYILRPRKPRHRLDAGTFGTLGVGLGYAIAA 60

Query: 132 ALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN 177
           AL      P KRVV V+GD AFGFSGMELET VRY LP+++V+  N
Sbjct: 61  ALAR----PDKRVVLVEGDGAFGFSGMELETAVRYNLPIVVVVGNN 102

Pseudomonas fluorescens biovar I BZL cleaves the acyloin linkage of benzoin producing 2 molecules of benzaldehyde and enabling the Pseudomonas to grow on benzoin as the sole carbon and energy source. OCoD has a role in the detoxification of oxalate, catalyzing the decarboxylation of oxalyl-CoA to formate. 2-HPCL is a peroxisomal enzyme which plays a role in the alpha-oxidation of 3-methyl-branched fatty acids, catalyzing the cleavage of 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde. All these enzymes depend on Mg2+ and TPP for activity. Length = 172
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|217223 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238973 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>gnl|CDD|238972 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>gnl|CDD|238968 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|238971 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>gnl|CDD|236312 PRK08617, PRK08617, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|235700 PRK06112, PRK06112, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236063 PRK07586, PRK07586, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181502 PRK08611, PRK08611, pyruvate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181285 PRK08199, PRK08199, thiamine pyrophosphate protein; Validated Back     alignment and domain information
>gnl|CDD|238963 cd02005, TPP_PDC_IPDC, Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>gnl|CDD|235931 PRK07092, PRK07092, benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|213733 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180569 PRK06456, PRK06456, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|238966 cd02008, TPP_IOR_alpha, Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>gnl|CDD|180780 PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|139002 PRK12474, PRK12474, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information
>gnl|CDD|236380 PRK09107, PRK09107, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|180570 PRK06457, PRK06457, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236076 PRK07710, PRK07710, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|132340 TIGR03297, Ppyr-DeCO2ase, phosphonopyruvate decarboxylase Back     alignment and domain information
>gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|226684 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|226470 COG3961, COG3961, Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|226469 COG3960, COG3960, Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>gnl|CDD|181344 PRK08273, PRK08273, thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>gnl|CDD|180614 PRK06546, PRK06546, pyruvate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|206520 pfam14352, DUF4402, Domain of unknown function (DUF4402) Back     alignment and domain information
>gnl|CDD|236243 PRK08327, PRK08327, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|238964 cd02006, TPP_Gcl, Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>gnl|CDD|183066 PRK11269, PRK11269, glyoxylate carboligase; Provisional Back     alignment and domain information
>gnl|CDD|213633 TIGR01504, glyox_carbo_lig, glyoxylate carboligase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.97
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.97
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 99.97
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.96
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.95
cd02003 205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.95
PLN02573578 pyruvate decarboxylase 99.95
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.95
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.95
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 99.95
PRK12474518 hypothetical protein; Provisional 99.95
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.95
PRK06154565 hypothetical protein; Provisional 99.95
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.95
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 99.94
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 99.94
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 99.94
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 99.94
PRK07586514 hypothetical protein; Validated 99.94
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 99.94
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 99.94
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.94
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 99.94
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 99.94
PRK08273 597 thiamine pyrophosphate protein; Provisional 99.94
PRK09124 574 pyruvate dehydrogenase; Provisional 99.94
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 99.94
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 99.94
PRK05858542 hypothetical protein; Provisional 99.94
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 99.94
PRK11269 591 glyoxylate carboligase; Provisional 99.94
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 99.94
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 99.94
PLN02470 585 acetolactate synthase 99.94
PRK06457549 pyruvate dehydrogenase; Provisional 99.93
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 99.93
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 99.93
KOG1184|consensus561 99.93
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 99.93
PRK08611 576 pyruvate oxidase; Provisional 99.93
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 99.93
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 99.93
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 99.93
PRK08617552 acetolactate synthase; Reviewed 99.93
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 99.93
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 99.93
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 99.93
PRK08322547 acetolactate synthase; Reviewed 99.93
PRK08155564 acetolactate synthase catalytic subunit; Validated 99.92
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 99.92
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 99.92
KOG1185|consensus571 99.92
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 99.92
PRK06163202 hypothetical protein; Provisional 99.92
PRK06546 578 pyruvate dehydrogenase; Provisional 99.92
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 99.92
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 99.91
PRK07524535 hypothetical protein; Provisional 99.91
PRK07064544 hypothetical protein; Provisional 99.91
PRK06112578 acetolactate synthase catalytic subunit; Validated 99.91
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.91
PRK08266542 hypothetical protein; Provisional 99.91
PRK08199557 thiamine pyrophosphate protein; Validated 99.9
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 99.9
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.9
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.89
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.89
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.89
PRK07092530 benzoylformate decarboxylase; Reviewed 99.89
PRK08327569 acetolactate synthase catalytic subunit; Validated 99.89
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.89
cd03376 235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.87
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.86
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.86
cd02018 237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.85
KOG4166|consensus675 99.83
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.83
PRK11867 286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.83
PRK09628 277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.82
PRK05778 301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.8
TIGR02177 287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.79
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.77
TIGR03336 595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.77
PRK11866 279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.77
PRK11869 280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.76
COG3962 617 Acetolactate synthase [Amino acid transport and me 99.64
COG3960 592 Glyoxylate carboligase [General function predictio 99.52
TIGR03181 341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 99.46
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 99.46
cd02000 293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 99.45
TIGR03182 315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 99.33
CHL00149 341 odpA pyruvate dehydrogenase E1 component alpha sub 99.31
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 99.25
PRK05899 624 transketolase; Reviewed 99.17
PLN02374 433 pyruvate dehydrogenase (acetyl-transferring) 99.07
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.01
PRK11865 299 pyruvate ferredoxin oxidoreductase subunit beta; P 98.83
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 98.79
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 98.77
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.7
PRK11864 300 2-ketoisovalerate ferredoxin oxidoreductase subuni 98.68
COG1013 294 PorB Pyruvate:ferredoxin oxidoreductase and relate 98.35
PLN02269 362 Pyruvate dehydrogenase E1 component subunit alpha 98.27
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 98.24
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 98.23
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 98.19
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 98.15
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 98.12
PF00456 332 Transketolase_N: Transketolase, thiamine diphospha 98.11
PTZ00089 661 transketolase; Provisional 98.08
PLN02790 654 transketolase 98.04
cd02017 386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 98.04
PRK12753 663 transketolase; Reviewed 98.04
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 97.97
PF00676 300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 97.97
PRK12754 663 transketolase; Reviewed 97.96
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 97.95
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 97.73
COG1071 358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 97.72
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 97.68
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 97.68
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 97.67
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 97.65
KOG0523|consensus 632 97.62
COG4231 640 Indolepyruvate ferredoxin oxidoreductase, alpha an 97.62
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 97.52
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 97.45
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 97.33
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 97.27
cd02011 227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 97.26
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 97.23
cd03377 365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 97.15
PRK05261 785 putative phosphoketolase; Provisional 96.62
KOG0225|consensus 394 96.57
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 96.44
COG0021 663 TktA Transketolase [Carbohydrate transport and met 96.35
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 95.98
KOG1182|consensus 432 94.99
PF09364 379 XFP_N: XFP N-terminal domain; InterPro: IPR018970 94.62
COG2609 887 AceE Pyruvate dehydrogenase complex, dehydrogenase 94.38
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 93.69
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 87.34
PRK07119 352 2-ketoisovalerate ferredoxin reductase; Validated 84.27
COG3957 793 Phosphoketolase [Carbohydrate transport and metabo 82.1
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 80.68
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information 
Probab=99.97  E-value=1.9e-31  Score=213.50  Aligned_cols=107  Identities=25%  Similarity=0.362  Sum_probs=97.7

Q ss_pred             CCCCCCHHHHHHHhhhhCCCCceEEccCc-chhHHHHHhhhccCCCceecCCCcccccchHHHHHHHHHHhhhcCCCCeE
Q psy15960         66 ESVPLNYYAAIHAVQVSIPDNCIIVGEGA-NTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRV  144 (177)
Q Consensus        66 ~~~~l~~~~~~~~l~~~l~~~~iiv~dg~-~~~~~~~~~~~~~~p~~~i~~~~~gsmG~~lpaAiGaala~~~~~p~r~v  144 (177)
                      ++.+++|.+++++|++.+|++++|++|++ +.+|+. +++....|++++.++++|+|||++|+||||++|    +|+|+|
T Consensus         4 ~~~~l~~~~~~~~l~~~l~~d~iiv~d~G~~~~~~~-~~~~~~~~~~~~~~~~~GsmG~~lpaaiGa~la----~p~~~v   78 (202)
T cd02006           4 DDVPIKPQRVYEEMNKAFGRDVRYVTTIGLSQIAGA-QMLHVYKPRHWINCGQAGPLGWTVPAALGVAAA----DPDRQV   78 (202)
T ss_pred             CCCCcCHHHHHHHHHhhCCCCeEEEECCcHHHHHHH-HhcCcCCCCeEEccCCccchhhhhHHHHhHHhh----CCCCeE
Confidence            35579999999999999999999999955 454554 457888999999999999999999999999999    799999


Q ss_pred             EEEEcchhhcccHHHHHHHHHcCCCcEEEEEeC
Q psy15960        145 VCVQGDSAFGFSGMELETLVRYRLPVILVILYN  177 (177)
Q Consensus       145 v~i~GDGsf~m~~qEL~Ta~r~~lpviiiVlNN  177 (177)
                      |+++|||||+|++|||+|++||++|+++||+||
T Consensus        79 v~i~GDG~f~m~~~eL~Ta~~~~lpviivV~NN  111 (202)
T cd02006          79 VALSGDYDFQFMIEELAVGAQHRIPYIHVLVNN  111 (202)
T ss_pred             EEEEeChHhhccHHHHHHHHHhCCCeEEEEEeC
Confidence            999999999999999999999999999999999

E. coli glyoxylate carboligase, plays a key role in glyoxylate metabolism where it catalyzes the condensation of two molecules of glyoxylate to give tartronic semialdehyde and carbon dioxide. This enzyme requires TPP, magnesium ion and FAD as cofactors.
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>KOG1184|consensus Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>KOG1185|consensus Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>KOG4166|consensus Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>KOG0523|consensus Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>KOG0225|consensus Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>KOG1182|consensus Back     alignment and domain information
>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
2q27_A564 Crystal Structure Of Oxalyl-Coa Decarboxylase From 2e-18
2c31_A568 Crystal Structure Of Oxalyl-Coa Decarboxylase In Co 7e-16
3iaf_A570 Structure Of Benzaldehyde Lyase A28s Mutant With Mo 6e-04
3iae_A570 Structure Of Benzaldehyde Lyase A28s Mutant With Be 6e-04
3d7k_A570 Crystal Structure Of Benzaldehyde Lyase In Complex 6e-04
2uz1_B563 1.65 Angstrom Structure Of Benzaldehyde Lyase Compl 6e-04
2ag0_A563 Crystal Structure Of Benzaldehyde Lyase (Bal)- Nati 6e-04
>pdb|2Q27|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase From Escherichia Coli Length = 564 Back     alignment and structure 
Iteration: 1

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 70/120 (58%), Gaps = 8/120 (6%)
Query: 60  EKMIQDESVPLNYYAAIHAVQVSIPDN--CIIVGEGANTMDIGRSLLLNNLPRHRLDAGT 117
           EK+  D + PLNY+ A+ AV+  + +N    +V EGANT+D  R+++    PR RLD GT
Sbjct: 361 EKLSTD-TQPLNYFNALSAVRDVLRENQDIYLVNEGANTLDNARNIIDMYKPRRRLDCGT 419
Query: 118 FGTMXXXXXXXXXXXXYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN 177
           +G M                   G  VV ++GDSAFGFSGME+ET+ RY LPV +VI  N
Sbjct: 420 WGVMGIGMGYAIGASVTS-----GSPVVAIEGDSAFGFSGMEIETICRYNLPVTIVIFNN 474
>pdb|2C31|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase In Complex With The Cofactor Derivative Thiamin-2-Thiazolone Diphosphate And Adenosine Diphosphate Length = 568 Back     alignment and structure
>pdb|3IAF|A Chain A, Structure Of Benzaldehyde Lyase A28s Mutant With Monomethyl Benzoylphosphonate Length = 570 Back     alignment and structure
>pdb|3IAE|A Chain A, Structure Of Benzaldehyde Lyase A28s Mutant With Benzoylphosphonate Length = 570 Back     alignment and structure
>pdb|3D7K|A Chain A, Crystal Structure Of Benzaldehyde Lyase In Complex With The Inhibitor Mbp Length = 570 Back     alignment and structure
>pdb|2UZ1|B Chain B, 1.65 Angstrom Structure Of Benzaldehyde Lyase Complexed With 2-Methyl-2,4-Pentanediol Length = 563 Back     alignment and structure
>pdb|2AG0|A Chain A, Crystal Structure Of Benzaldehyde Lyase (Bal)- Native Length = 563 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 4e-30
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 7e-30
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 3e-15
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 6e-15
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 8e-13
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 2e-12
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 3e-12
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 3e-12
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 5e-12
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 9e-12
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 1e-11
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 2e-11
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 3e-11
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 4e-11
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 6e-11
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 2e-10
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 3e-10
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 6e-10
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 6e-10
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 1e-09
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1e-08
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 4e-07
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
 Score =  113 bits (286), Expect = 4e-30
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 7/115 (6%)

Query: 65  DESVPLNYYAAIHAVQVSI--PDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMG 122
             S  +NY  ++  V+  +    +  +V EGAN +D  R ++    PR RLD+GT+G MG
Sbjct: 370 TPSGMMNYSNSLGVVRDFMLANPDISLVNEGANALDNTRMIVDMLKPRKRLDSGTWGVMG 429

Query: 123 VGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN 177
           +G+G+ +AAA        GK V+ V+GDSAFGFSGMELET+ RY LPV ++I+ N
Sbjct: 430 IGMGYCVAAAA-----VTGKPVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNN 479
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Length = 570 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Length = 590 Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Length = 552 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Length = 566 Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Length = 568 Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Length = 604 Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Length = 578 Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Length = 556 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 99.91
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 99.9
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 99.9
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 99.9
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 99.9
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 99.89
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 99.89
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 99.89
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 99.89
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 99.89
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 99.89
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 99.89
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 99.89
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 99.89
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 99.88
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 99.88
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 99.88
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 99.88
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 99.87
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 99.86
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.83
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.82
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 99.57
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 99.49
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 99.42
1umd_A 367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 99.4
2bfd_A 400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 99.37
1w85_A 368 Pyruvate dehydrogenase E1 component, alpha subunit 99.36
1qs0_A 407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 99.32
2ozl_A 365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 99.3
3l84_A 632 Transketolase; TKT, structural genomics, center fo 99.27
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 99.19
3uk1_A 711 Transketolase; structural genomics, seattle struct 99.17
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 99.17
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 99.16
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 99.16
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 99.16
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 99.12
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 99.11
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 99.04
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 98.57
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 98.54
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 98.48
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 98.43
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 98.33
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 96.06
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
Probab=99.91  E-value=3.5e-24  Score=192.24  Aligned_cols=151  Identities=17%  Similarity=0.210  Sum_probs=112.9

Q ss_pred             ceeCCcchHHHHHh-cc-ccccccccCCCCcccchhhhhhccCCCCCCCHHHHHHHhhhhCCCCceEEccCcchhHHHHH
Q psy15960         25 GARRRIRMRDLIQR-AK-VEEGEMKVGGNMRGVDSAVEKMIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRS  102 (177)
Q Consensus        25 ~~~~~v~~~~~l~~-~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~l~~~l~~~~iiv~dg~~~~~~~~~  102 (177)
                      ..+.++.++++|++ ++ +......+.. .+.+...........+.++++.++++.|++.+++++++++|.|+..+. ..
T Consensus       319 ~~~~~~~~~~~l~~L~~~l~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~iv~~d~G~~~~~-~~  396 (563)
T 2vk8_A          319 ATFPGVQMKFVLQKLLTTIADAAKGYKP-VAVPARTPANAAVPASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFG-IN  396 (563)
T ss_dssp             EEEETCCHHHHHHHHHHHHHHHTTTCCC-CCCCCCCCCCCCCCTTCBCCHHHHHHHHTTTCCTTCEEEECTTHHHHH-GG
T ss_pred             cccCCcCHHHHHHHHHHhhccccchhhh-hhhhhhcccccCCCCCCCcCHHHHHHHHHHhCCCCCEEEECCchHHHH-Hh
Confidence            35567888999988 54 3321111110 111111101111113457999999999999999999999995555443 34


Q ss_pred             hhhccCCCceecCCCcccccchHHHHHHHHHHhhhcCCCCeEEEEEcchhhcccHHHHHHHHHcCCCcEEEEEeC
Q psy15960        103 LLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN  177 (177)
Q Consensus       103 ~~~~~~p~~~i~~~~~gsmG~~lpaAiGaala~~~~~p~r~vv~i~GDGsf~m~~qEL~Ta~r~~lpviiiVlNN  177 (177)
                      ++..+.+.+++.++++|+||+++|+|+|+++|.++...+++||+++|||||+|++|||+|++++++|+++||+||
T Consensus       397 ~~~~~~~~~~~~~~~~g~mG~~l~~A~Gaala~~~~~~~~~vv~~~GDG~~~~~~~el~ta~~~~l~~~ivv~nN  471 (563)
T 2vk8_A          397 QTTFPNNTYGISQVLWGSIGFTTGATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNN  471 (563)
T ss_dssp             GSCCCSSCEEECCTTTCCTTHHHHHHHHHHHHHHHHCTTCCEEEEEEHHHHHHHGGGHHHHHHTTCCCEEEEEES
T ss_pred             hcCcCCCCeEEcccchhhhhhHHHHHHHHHHhCcccCCCCCEEEEEcchHhhccHHHHHHHHHcCCCcEEEEEEC
Confidence            466777888999999999999999999999996444445999999999999999999999999999999999999
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d2ji7a3183 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxa 8e-16
d1pvda3196 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker 2e-12
d1zpda3204 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymom 9e-12
d2djia3 229 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus 1e-08
d1ybha3 208 c.36.1.9 (A:460-667) Acetohydroxyacid synthase cat 1e-07
d1q6za3183 c.36.1.9 (A:342-524) Benzoylformate decarboxylase 1e-07
d1ovma3196 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxyla 2e-07
d2ihta3198 c.36.1.9 (A:375-572) Carboxyethylarginine synthase 1e-06
d2ez9a3 228 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacill 5e-06
d1ozha3192 c.36.1.9 (A:367-558) Catabolic acetolactate syntha 0.001
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase PP module
domain: Oxalyl-CoA decarboxylase
species: Oxalobacter formigenes [TaxId: 847]

 Score = 69.2 bits (168), Expect = 8e-16
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 7/111 (6%)

Query: 69  PLNYYAAIHAVQVSIPDN--CIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLG 126
            +NY  ++  V+  +  N    +V EGAN +D  R ++    PR RLD+GT+G MG+G+G
Sbjct: 5   MMNYSNSLGVVRDFMLANPDISLVNEGANALDNTRMIVDMLKPRKRLDSGTWGVMGIGMG 64

Query: 127 FALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLVRYRLPVILVILYN 177
                         GK V+ V+GDSAFGFSGMELET+ RY LPV ++I+ N
Sbjct: 65  -----YCVAAAAVTGKPVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNN 110
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 204 Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 229 Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 208 Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Length = 183 Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 196 Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 198 Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 228 Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d2ez9a3 228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.97
d1ybha3 208 Acetohydroxyacid synthase catalytic subunit {Thale 99.97
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.96
d2djia3 229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.96
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.96
d1t9ba3 227 Acetohydroxyacid synthase catalytic subunit {Baker 99.96
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.96
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.96
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.96
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.95
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.94
d1w85a_ 365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 98.32
d2ozla1 361 E1-beta subunit of pyruvate dehydrogenase (PP modu 98.3
d2r8oa2 331 Transketolase (TK), PP module {Escherichia coli [T 98.23
d1umda_ 362 Branched-chain alpha-keto acid dehydrogenase, PP m 98.19
d1gpua1 335 Transketolase (TK), PP module {Baker's yeast (Sacc 98.18
d1qs0a_ 407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 98.16
d1r9ja2 336 Transketolase (TK), PP module {Leishmania mexicana 98.15
d2bfda1 395 Branched-chain alpha-keto acid dehydrogenase, PP m 98.14
d1itza1 338 Transketolase (TK), PP module {Maize (Zea mays) [T 98.02
d2c42a2 447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 97.75
d2ieaa2 415 Pyruvate dehydrogenase E1 component, PP module {Es 96.88
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Pyruvate oxidase and decarboxylase PP module
domain: Pyruvate oxidase
species: Lactobacillus plantarum [TaxId: 1590]

Probab=99.97  E-value=5.2e-32  Score=217.89  Aligned_cols=108  Identities=29%  Similarity=0.377  Sum_probs=99.6

Q ss_pred             CCCCCCHHHHHHHhhhhCCCCceEEccCcchhHHHHHhhhccCCCceecCCCcccccchHHHHHHHHHHhhhcCCCCeEE
Q psy15960         66 ESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVV  145 (177)
Q Consensus        66 ~~~~l~~~~~~~~l~~~l~~~~iiv~dg~~~~~~~~~~~~~~~p~~~i~~~~~gsmG~~lpaAiGaala~~~~~p~r~vv  145 (177)
                      +++||+|++++++|++.+|+|+|+++|+|+...++.++++.+.|++++.++++|+|||++|+||||++|    .|+|+||
T Consensus         2 ~~gpi~p~~v~~~l~~~l~~d~ivv~D~G~~~~~~~~~~~~~~p~~~~~~~~~g~mG~glpaAiGa~la----~p~~~Vv   77 (228)
T d2ez9a3           2 QEGPLQAYQVLRAVNKIAEPDAIYSIDVGDINLNANRHLKLTPSNRHITSNLFATMGVGIPGAIAAKLN----YPERQVF   77 (228)
T ss_dssp             CSSBCCHHHHHHHHHHHCCTTCEEEECSSHHHHHHHHHCCCCTTCEEECCCSSCCTTCHHHHHHHHHHH----CTTSCEE
T ss_pred             CCCCcCHHHHHHHHHhhCCCCeEEEEcCcHHHHHHHHHccCCCCceeeeecccccccccchhhhhhhhh----hccceeE
Confidence            467899999999999999999999999554434444558899999999999999999999999999999    7999999


Q ss_pred             EEEcchhhcccHHHHHHHHHcCCCcEEEEEeC
Q psy15960        146 CVQGDSAFGFSGMELETLVRYRLPVILVILYN  177 (177)
Q Consensus       146 ~i~GDGsf~m~~qEL~Ta~r~~lpviiiVlNN  177 (177)
                      |++|||||+|++|||+|++||++|+++||+||
T Consensus        78 ~i~GDG~f~m~~~EL~Ta~~~~lpi~~vV~NN  109 (228)
T d2ez9a3          78 NLAGDGGASMTMQDLATQVQYHLPVINVVFTN  109 (228)
T ss_dssp             EEEEHHHHHHHGGGHHHHHHTTCCCEEEEEEC
T ss_pred             eecCCccccccchhhhhhccccCceEEEEecc
Confidence            99999999999999999999999999999999
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure