Diaphorina citri psyllid: psy15969


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MVEKRRKKEKKKKKKKKKKKKKKKKKTCKRKEEPDISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRSMDKWKDDDPPKP
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHcccHHHcccccccccccccc
**EKRRKK*****************************************VFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMN*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEPDISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRSMDKWKDDDPPKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein onecut Transcriptional regulator. Binds and recognize ATTG sites.confidentQ9NJB5
Hepatocyte nuclear factor 6 Transcriptional activator. Binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. Important for liver genes transcription.confidentQ9UBC0
Hepatocyte nuclear factor 6 Transcriptional activator. Binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. Important for liver genes transcription. The affinity of HNF-6-alpha and HNF-6-beta for DNA differs depending on the target sequence.confidentP70512

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionconfidentGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterconfidentGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0001952 [BP]regulation of cell-matrix adhesionprobableGO:0010810, GO:0030155, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0002064 [BP]epithelial cell developmentprobableGO:0032502, GO:0060429, GO:0048869, GO:0030154, GO:0048468, GO:0009888, GO:0044767, GO:0044763, GO:0030855, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0030335 [BP]positive regulation of cell migrationprobableGO:0051272, GO:0030334, GO:0040017, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0031018 [BP]endocrine pancreas developmentprobableGO:0032502, GO:0048856, GO:0044707, GO:0032501, GO:0031016, GO:0044767, GO:0035270, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0030512 [BP]negative regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042384 [BP]cilium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0010927, GO:0009653, GO:0044699, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0060271, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0032990, GO:0006996, GO:0048858, GO:0048856, GO:0044085, GO:0008150, GO:0044782
GO:0045165 [BP]cell fate commitmentprobableGO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0007492 [BP]endoderm developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0030183 [BP]B cell differentiationprobableGO:0030154, GO:0042113, GO:0045321, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0048534, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0001775, GO:0046649, GO:0044763, GO:0048731, GO:0002521, GO:0002520, GO:0044707, GO:0048856, GO:0030097, GO:0002376, GO:0030098, GO:0008150
GO:0035622 [BP]intrahepatic bile duct developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0061008, GO:0048856, GO:0044767, GO:0048513, GO:0001889, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0048935 [BP]peripheral nervous system neuron developmentprobableGO:0048666, GO:0032502, GO:0048699, GO:0048856, GO:0030182, GO:0007399, GO:0007422, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0008150, GO:0048934, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0006006 [BP]glucose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0048536 [BP]spleen developmentprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D5V, chain A
Confidence level:very confident
Coverage over the Query: 33-106
View the alignment between query and template
View the model in PyMOL