Psyllid ID: psy15969

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MVEKRRKKEKKKKKKKKKKKKKKKKKTCKRKEEPDISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRSMDKWKDDDPPKP
cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHcccHHHcccccccccccccc
ccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHccccccccc
MVEKRRKKEKKKKKKKKKKKKKkkkktckrkeepdisqdqsstpkkprlvfTDLQRRTLQAIFKETKRPSKEMQVTIARQlglepttvgnffMNARRrsmdkwkdddppkp
mvekrrkkekkkkkkkkkkkkkkkkktckrkeepdisqdqsstpkkprlvftdLQRRTLQAIfketkrpskemQVTIarqlglepttvgnffmnarrrsmdkwkdddppkp
MVekrrkkekkkkkkkkkkkkkkkkktckrkeePDISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRSMdkwkdddppkp
*************************************************VFTDLQRRTLQAIF***********VTIARQLGLEPTTVGNFFM******************
**EKRRKK********************************************DLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMN*****************
*********************************************KPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRS************
*VEKRRKKEKKKKKKKKKKKKKKKKKTCKRK**************KPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRSMD**********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEPDISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRSMDKWKDDDPPKP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q9NJB51081 Homeobox protein onecut O yes N/A 0.711 0.073 0.876 2e-33
O08755465 Hepatocyte nuclear factor yes N/A 0.927 0.221 0.576 5e-26
P70512465 Hepatocyte nuclear factor yes N/A 0.927 0.221 0.576 6e-26
Q9UBC0465 Hepatocyte nuclear factor yes N/A 0.927 0.221 0.576 4e-25
O95948504 One cut domain family mem no N/A 0.927 0.204 0.576 1e-23
Q6XBJ3505 One cut domain family mem no N/A 0.927 0.203 0.576 2e-23
O60422494 One cut domain family mem no N/A 0.972 0.218 0.532 3e-22
Q8K557490 One cut domain family mem no N/A 0.927 0.210 0.548 9e-22
Q19720 641 Homeobox protein ceh-38 O no N/A 0.711 0.123 0.582 4e-15
Q22811495 Homeobox protein ceh-21 O no N/A 0.504 0.113 0.482 4e-08
>sp|Q9NJB5|ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster GN=onecut PE=2 SV=2 Back     alignment and function desciption
 Score =  140 bits (353), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 71/81 (87%), Positives = 75/81 (92%), Gaps = 2/81 (2%)

Query: 27  TCKRKEEPDISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPT 86
           +C+RKEEP I  +Q   PKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPT
Sbjct: 905 SCRRKEEPQI--EQMPQPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPT 962

Query: 87  TVGNFFMNARRRSMDKWKDDD 107
           TVGNFFMNARRRSMDKW+DDD
Sbjct: 963 TVGNFFMNARRRSMDKWRDDD 983
Transcriptional regulator. Binds and recognize ATTG sites.
Drosophila melanogaster (taxid: 7227)
>sp|O08755|HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus GN=Onecut1 PE=1 SV=1 Back     alignment and function description
>sp|P70512|HNF6_RAT Hepatocyte nuclear factor 6 OS=Rattus norvegicus GN=Onecut1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UBC0|HNF6_HUMAN Hepatocyte nuclear factor 6 OS=Homo sapiens GN=ONECUT1 PE=2 SV=1 Back     alignment and function description
>sp|O95948|ONEC2_HUMAN One cut domain family member 2 OS=Homo sapiens GN=ONECUT2 PE=2 SV=2 Back     alignment and function description
>sp|Q6XBJ3|ONEC2_MOUSE One cut domain family member 2 OS=Mus musculus GN=Onecut2 PE=2 SV=2 Back     alignment and function description
>sp|O60422|ONEC3_HUMAN One cut domain family member 3 OS=Homo sapiens GN=ONECUT3 PE=2 SV=2 Back     alignment and function description
>sp|Q8K557|ONEC3_MOUSE One cut domain family member 3 OS=Mus musculus GN=Onecut3 PE=1 SV=2 Back     alignment and function description
>sp|Q19720|HM38_CAEEL Homeobox protein ceh-38 OS=Caenorhabditis elegans GN=ceh-38 PE=2 SV=2 Back     alignment and function description
>sp|Q22811|HM21_CAEEL Homeobox protein ceh-21 OS=Caenorhabditis elegans GN=ceh-21 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
270014519 565 hypothetical protein TcasGA2_TC004129 [T 0.729 0.143 0.901 1e-35
189233657 1151 PREDICTED: similar to GA15133-PA [Tribol 0.729 0.070 0.901 1e-35
357607758 365 putative One cut domain family member 2 0.765 0.232 0.827 1e-34
195402213 1074 GJ19930 [Drosophila virilis] gi|19415591 0.702 0.072 0.887 3e-34
263359692 1076 hypothetical protein DVIR88_6g0065 [Dros 0.702 0.072 0.887 9e-34
380016009 510 PREDICTED: one cut domain family member 0.954 0.207 0.682 1e-33
195450723 1032 GK13692 [Drosophila willistoni] gi|19416 0.711 0.076 0.876 2e-33
195133982 1059 GI14052 [Drosophila mojavensis] gi|19391 0.711 0.074 0.876 2e-33
350426167 225 PREDICTED: hepatocyte nuclear factor 6-l 0.756 0.373 0.823 5e-33
198462296 1018 GA15133 [Drosophila pseudoobscura pseudo 0.702 0.076 0.887 6e-33
>gi|270014519|gb|EFA10967.1| hypothetical protein TcasGA2_TC004129 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 75/81 (92%)

Query: 28  CKRKEEPDISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTT 87
           CKRKEE   + DQ  TPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTT
Sbjct: 447 CKRKEESSNNSDQLPTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTT 506

Query: 88  VGNFFMNARRRSMDKWKDDDP 108
           VGNFFMNARRRSMDKWKD+DP
Sbjct: 507 VGNFFMNARRRSMDKWKDEDP 527

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189233657|ref|XP_001807372.1| PREDICTED: similar to GA15133-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357607758|gb|EHJ65677.1| putative One cut domain family member 2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195402213|ref|XP_002059701.1| GJ19930 [Drosophila virilis] gi|194155915|gb|EDW71099.1| GJ19930 [Drosophila virilis] Back     alignment and taxonomy information
>gi|263359692|gb|ACY70528.1| hypothetical protein DVIR88_6g0065 [Drosophila virilis] Back     alignment and taxonomy information
>gi|380016009|ref|XP_003691986.1| PREDICTED: one cut domain family member 2-like [Apis florea] Back     alignment and taxonomy information
>gi|195450723|ref|XP_002072605.1| GK13692 [Drosophila willistoni] gi|194168690|gb|EDW83591.1| GK13692 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195133982|ref|XP_002011417.1| GI14052 [Drosophila mojavensis] gi|193912040|gb|EDW10907.1| GI14052 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|350426167|ref|XP_003494354.1| PREDICTED: hepatocyte nuclear factor 6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|198462296|ref|XP_001382225.2| GA15133 [Drosophila pseudoobscura pseudoobscura] gi|198140047|gb|EAL29279.2| GA15133 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
FB|FBgn00289961081 onecut "onecut" [Drosophila me 0.558 0.057 0.935 2.2e-24
ZFIN|ZDB-GENE-120215-73459 si:ch1073-41k10.1 "si:ch1073-4 0.594 0.143 0.787 8.5e-22
UNIPROTKB|F1NMD990 F1NMD9 "Uncharacterized protei 0.567 0.7 0.761 9e-22
UNIPROTKB|G3N248465 ONECUT1 "Uncharacterized prote 0.567 0.135 0.761 3.2e-21
UNIPROTKB|E2R096465 ONECUT1 "Uncharacterized prote 0.567 0.135 0.761 3.2e-21
UNIPROTKB|Q9UBC0465 ONECUT1 "Hepatocyte nuclear fa 0.567 0.135 0.761 3.2e-21
UNIPROTKB|F1RZD6465 ONECUT1 "Uncharacterized prote 0.567 0.135 0.761 3.2e-21
MGI|MGI:1196423465 Onecut1 "one cut domain, famil 0.567 0.135 0.761 3.2e-21
RGD|2811465 Onecut1 "one cut homeobox 1" [ 0.567 0.135 0.761 3.2e-21
UNIPROTKB|P70512465 Onecut1 "Hepatocyte nuclear fa 0.567 0.135 0.761 3.2e-21
FB|FBgn0028996 onecut "onecut" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 291 (107.5 bits), Expect = 2.2e-24, P = 2.2e-24
 Identities = 58/62 (93%), Positives = 59/62 (95%)

Query:    39 DQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRR 98
             +Q   PKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRR
Sbjct:   915 EQMPQPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRR 974

Query:    99 SM 100
             SM
Sbjct:   975 SM 976
GO:0006351 "transcription, DNA-dependent" evidence=ISS
GO:0005634 "nucleus" evidence=ISS;NAS;IDA
GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=NAS
GO:0003677 "DNA binding" evidence=NAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
ZFIN|ZDB-GENE-120215-73 si:ch1073-41k10.1 "si:ch1073-41k10.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMD9 F1NMD9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3N248 ONECUT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R096 ONECUT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBC0 ONECUT1 "Hepatocyte nuclear factor 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZD6 ONECUT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1196423 Onecut1 "one cut domain, family member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2811 Onecut1 "one cut homeobox 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P70512 Onecut1 "Hepatocyte nuclear factor 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O08755HNF6_MOUSENo assigned EC number0.57690.92790.2215yesN/A
Q9UBC0HNF6_HUMANNo assigned EC number0.57690.92790.2215yesN/A
P70512HNF6_RATNo assigned EC number0.57690.92790.2215yesN/A
Q9NJB5ONEC_DROMENo assigned EC number0.87650.71170.0730yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
smart0038957 smart00389, HOX, Homeodomain 2e-08
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-07
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-07
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 3e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 4e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 8e-04
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.001
pfam13148 379 pfam13148, DUF3987, Protein of unknown function (D 0.001
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.002
PRK11778 330 PRK11778, PRK11778, putative inner membrane peptid 0.002
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.003
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.004
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information 
 Score = 46.5 bits (111), Expect = 2e-08
 Identities = 17/56 (30%), Positives = 29/56 (51%)

Query: 44 PKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRS 99
           ++ R  FT  Q   L+  F++   PS+E +  +A++LGL    V  +F N R + 
Sbjct: 1  KRRKRTSFTPEQLEELEKEFQKNPYPSREEREELAKKLGLSERQVKVWFQNRRAKW 56

DNA-binding factors that are involved in the transcriptional regulation of key developmental processes. Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|221937 pfam13148, DUF3987, Protein of unknown function (DUF3987) Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.69
KOG0489|consensus261 99.68
KOG0488|consensus309 99.68
KOG0842|consensus307 99.67
KOG0843|consensus197 99.66
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.64
KOG0484|consensus125 99.64
KOG0850|consensus245 99.63
KOG2251|consensus 228 99.59
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.58
KOG0485|consensus 268 99.58
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.57
KOG0487|consensus308 99.56
KOG0492|consensus246 99.52
KOG0494|consensus 332 99.49
COG5576156 Homeodomain-containing transcription factor [Trans 99.49
KOG4577|consensus 383 99.46
KOG3802|consensus398 99.45
KOG0848|consensus317 99.43
KOG0493|consensus342 99.43
KOG0491|consensus194 99.38
KOG0483|consensus198 99.37
KOG0844|consensus 408 99.35
KOG2252|consensus558 99.27
KOG0486|consensus 351 99.26
KOG0847|consensus288 99.23
KOG0490|consensus 235 99.15
KOG0849|consensus 354 99.11
KOG0775|consensus304 99.03
KOG1168|consensus385 98.99
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.73
KOG0774|consensus334 98.59
KOG0490|consensus235 98.13
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.39
KOG1146|consensus 1406 97.24
KOG0773|consensus342 97.22
KOG3623|consensus 1007 95.42
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.28
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 89.51
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 85.28
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 80.97
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information 
Probab=99.69  E-value=1.3e-17  Score=98.42  Aligned_cols=53  Identities=42%  Similarity=0.617  Sum_probs=51.4

Q ss_pred             CCCCCcCCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCCccccccccccccc
Q psy15969         45 KKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARR   97 (111)
Q Consensus        45 rr~Rt~ft~~ql~~Le~~F~~~~~ps~~~r~~LA~~lgL~~~qVkvWFqNrR~   97 (111)
                      ++.|+.||++|+.+|+.+|..++||+..++..||..|||+..+|.+||+|+|+
T Consensus         1 kr~r~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~l~l~~~~V~~WF~nrR~   53 (57)
T PF00046_consen    1 KRKRTRFTKEQLKVLEEYFQENPYPSKEEREELAKELGLTERQVKNWFQNRRR   53 (57)
T ss_dssp             SSSSSSSSHHHHHHHHHHHHHSSSCHHHHHHHHHHHHTSSHHHHHHHHHHHHH
T ss_pred             CcCCCCCCHHHHHHHHHHHHHhccccccccccccccccccccccccCHHHhHH
Confidence            46789999999999999999999999999999999999999999999999999

; InterPro: IPR001356 The homeobox domain was first identified in a number of drosophila homeotic and segmentation proteins, but is now known to be well-conserved in many other animals, including vertebrates [, , ]. Hox genes encode homeodomain-containing transcriptional regulators that operate differential genetic programs along the anterior-posterior axis of animal bodies []. The domain binds DNA through a helix-turn-helix (HTH) structure. The HTH motif is characterised by two alpha-helices, which make intimate contacts with the DNA and are joined by a short turn. The second helix binds to DNA via a number of hydrogen bonds and hydrophobic interactions, which occur between specific side chains and the exposed bases and thymine methyl groups within the major groove of the DNA []. The first helix helps to stabilise the structure. The motif is very similar in sequence and structure in a wide range of DNA-binding proteins (e.g., cro and repressor proteins, homeotic proteins, etc.). One of the principal differences between HTH motifs in these different proteins arises from the stereo-chemical requirement for glycine in the turn which is needed to avoid steric interference of the beta-carbon with the main chain: for cro and repressor proteins the glycine appears to be mandatory, while for many of the homeotic and other DNA-binding proteins the requirement is relaxed.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2DA3_A 1LFB_A 2LFB_A 2ECB_A 2DA5_A 3D1N_O 3A03_A 2XSD_C 3CMY_A 1AHD_P ....
>KOG0489|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
2d5v_A164 Crystal Structure Of Hnf-6alpha Dna-Binding Domain 8e-24
1s7e_A147 Solution Structure Of Hnf-6 Length = 147 6e-22
>pdb|2D5V|A Chain A, Crystal Structure Of Hnf-6alpha Dna-Binding Domain In Complex With The Ttr Promoter Length = 164 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (261), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 48/66 (72%), Positives = 59/66 (89%)
Query: 35  DISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMN 94
           +  +D+ +TPKKPRLVFTD+QRRTL AIFKE KRPSKE+Q+TI++QLGLE +TV NFFMN
Sbjct: 88  EHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMN 147
Query: 95  ARRRSM 100
           ARRRS+
Sbjct: 148 ARRRSL 153
>pdb|1S7E|A Chain A, Solution Structure Of Hnf-6 Length = 147 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-12
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 7e-06
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-05
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 6e-05
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-04
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-04
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 3e-04
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
 Score = 59.9 bits (144), Expect = 1e-12
 Identities = 52/94 (55%), Positives = 73/94 (77%)

Query: 14  KKKKKKKKKKKKKTCKRKEEPDISQDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEM 73
           ++ + ++    +    +++E +  +D+ +TPKKPRLVFTD+QRRTL AIFKE KRPSKE+
Sbjct: 67  QEPEFQRMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKEL 126

Query: 74  QVTIARQLGLEPTTVGNFFMNARRRSMDKWKDDD 107
           Q+TI++QLGLE +TV NFFMNARRRS+DKW +  
Sbjct: 127 QITISQQLGLELSTVSNFFMNARRRSLDKWLEHH 160
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.83
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.83
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.82
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.82
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.82
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.81
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.81
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.81
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.8
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.8
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.8
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.8
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.8
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.8
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.8
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.8
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.79
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.79
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.79
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.79
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.79
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.79
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.78
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.78
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.78
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.78
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.78
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.78
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.78
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.78
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.78
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.78
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.78
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.77
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.77
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.77
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.77
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.76
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.76
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.75
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.75
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.75
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.75
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.75
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.75
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.74
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.74
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.74
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.74
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.73
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.72
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.7
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.7
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.7
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.7
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.7
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.7
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.69
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.69
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.69
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.69
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.69
2e19_A64 Transcription factor 8; homeobox domain, structura 99.69
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.68
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.67
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.67
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.67
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.66
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.64
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.6
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.54
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.51
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.49
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.44
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.31
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.3
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.23
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 88.94
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 82.25
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 81.29
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.83  E-value=8e-21  Score=118.99  Aligned_cols=68  Identities=31%  Similarity=0.525  Sum_probs=61.9

Q ss_pred             CCCCCCCCCCCCcCCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCCcccccccccccccCCcccccccCCC
Q psy15969         38 QDQSSTPKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRSMDKWKDDDPP  109 (111)
Q Consensus        38 ~~~~~~~rr~Rt~ft~~ql~~Le~~F~~~~~ps~~~r~~LA~~lgL~~~qVkvWFqNrR~R~~~K~kr~~~~  109 (111)
                      ++.....++.|+.||.+|+.+|+.+|..++||+..++..||..|||++.+|++||||+|+    ++++....
T Consensus        11 ~~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~----k~kk~~~s   78 (80)
T 2dmt_A           11 GTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRM----KWKKSGPS   78 (80)
T ss_dssp             CCCCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHH----HHSCCCSC
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHH----HhhcccCC
Confidence            344566788999999999999999999999999999999999999999999999999999    88887654
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-07
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-05
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 6e-05
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 9e-05
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-04
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-04
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-04
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-04
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-04
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-04
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 3e-04
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 4e-04
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-04
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 5e-04
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 0.001
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 0.001
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 0.002
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 0.002
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 0.002
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 0.003
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 0.003
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 0.004
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Hepatocyte nuclear factor 6
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 42.2 bits (99), Expect = 2e-07
 Identities = 40/50 (80%), Positives = 46/50 (92%)

Query: 47 PRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNAR 96
          PRLVFTD+QRRTL AIFKE KRPSKE+Q+TI++QLGLE +TV NFFMNAR
Sbjct: 1  PRLVFTDVQRRTLHAIFKENKRPSKELQITISQQLGLELSTVSNFFMNAR 50
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.86
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.84
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.84
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.84
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.84
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.84
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.84
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.83
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.83
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.82
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.81
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.81
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.81
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.8
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.8
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.8
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.8
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.79
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.79
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.78
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.77
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.77
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.77
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.74
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.7
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.7
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.66
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.64
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.63
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.6
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.59
d1hlva166 DNA-binding domain of centromere binding protein B 92.15
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 89.31
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=1.2e-22  Score=119.43  Aligned_cols=58  Identities=24%  Similarity=0.300  Sum_probs=54.5

Q ss_pred             CCCCCCcCCHHHHHHHHHHHhhCCCCCHHHHHHHHHHhCCCcccccccccccccCCcccccc
Q psy15969         44 PKKPRLVFTDLQRRTLQAIFKETKRPSKEMQVTIARQLGLEPTTVGNFFMNARRRSMDKWKD  105 (111)
Q Consensus        44 ~rr~Rt~ft~~ql~~Le~~F~~~~~ps~~~r~~LA~~lgL~~~qVkvWFqNrR~R~~~K~kr  105 (111)
                      +++.|+.||++|+.+|+.+|..|+||+..++..||..|||++.+|++||||+|+    ++++
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~----k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRV----KEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHH----TTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhh----hccC
Confidence            367899999999999999999999999999999999999999999999999999    6653
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure