Diaphorina citri psyllid: psy15991


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MFKIQCELSFVLFSITVVHAVLSGLYVDNGVDQIIQRTLSTKEKQDVSHDLLNLLGLPLRPKHLFSNATSIEGSVPKFLMDIYRSLDNPRRTTRSEFNLGGKDLQSIDESDMIMGFSSRNHHVSNVRHEHGKRIWFDVSEVPPGETIVNSELRIYQMINTTADPWLQFTVSIYQVLVDGELEYVDSVNTTAGSEGWMLFNVTGPLVSWVAIPHSNKGLYLSVQPREKPIHEIRTEDIGIVASKVMHLEEKQPFMVAFFKSAHGGITVRPRSRRIRETTKSRKRKSMTETSNYRNPYTGFSDSMKEAAYNSHSCSIQTLYVNFRDLEWQDWIIAPDGYGAFYCKQKYNSDPFRVNYENIPEYKRFLEAKRNLQNVPPKPQSLMCWAIHNLEDSN
ccHHHHHHHHHHHHHHHHHHHHcccEEccccccHHcccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccEEEEccccccccccccccccEEEEEEcccccccccEEEEEEEEEEccccccccccEEEEEEEEEEcccccEEEEEEEEccccccEEEEEccHHHHHHHccccccccEEEEEEcccccccccccccccEEcccccccccccccEEEEEEcccccccccccccHHHHHHccccccccccccccccccccccccccHccccccccCEEEEEEEEEEccccccEEcccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccc
MFKIQCELSFVLFSITVVHAVLSGLYVDNGVDQIIQRTLSTKEKQDVSHDLLNLLGLPLRPKHLFSNATSIEGSVPKFLMDIYRSL****************DLQSIDESDMIMGFSSRNHHVSNVRHEHGKRIWFDVSEVPPGETIVNSELRIYQMINTTADPWLQFTVSIYQVLVDGELEYVDSVNTTAGSEGWMLFNVTGPLVSWVAIPHSNKGLYLSVQPREKPIHEIRTEDIGIVASKVMHLEEKQPFMVAFFKSA*************************************************HSCSIQTLYVNFRDLEWQDWIIAPDGYGAFYCKQKYNSDPFRVNYENIPEYKRFLEAKRNLQNVPPKPQSLMCWAIHNLE***
xxxxxxxxxxxxxxHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKIQCELSFVLFSITVVHAVLSGLYVDNGVDQIIQRTLSTKEKQDVSHDLLNLLGLPLRPKHLFSNATSIEGSVPKFLMDIYRSLDNPRRTTRSEFNLGGKDLQSIDESDMIMGFSSRNHHVSNVRHEHGKRIWFDVSEVPPGETIVNSELRIYQMINTTADPWLQFTVSIYQVLVDGELEYVDSVNTTAGSEGWMLFNVTGPLVSWVAIPHSNKGLYLSVQPREKPIHEIRTEDIGIVASKVMHLEEKQPFMVAFFKSAHGGITVRPRSRRIRETTKSRKRKSMTETSNYRNPYTGFSDSMKEAAYNSHSCSIQTLYVNFRDLEWQDWIIAPDGYGAFYCKQKYNSDPFRVNYENIPEYKRFLEAKRNLQNVPPKPQSLMCWAIHNLEDSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bone morphogenetic protein 7 Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.confidentP18075
Bone morphogenetic protein 7 Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.confidentP23359
Protein 60A Required for the growth of imaginal tissues and for patterning of the adult wing.confidentP27091

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045664 [BP]regulation of neuron differentiationprobableGO:0030154, GO:0007275, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0050789, GO:0008150, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0044707, GO:0048856, GO:0051960, GO:2000026, GO:0048731
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0050679 [BP]positive regulation of epithelial cell proliferationprobableGO:0008284, GO:0042127, GO:0050678, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0031988 [CC]membrane-bounded vesicleprobableGO:0005575, GO:0031982, GO:0043226
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0009892 [BP]negative regulation of metabolic processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0019222
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0060429 [BP]epithelium developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0031328 [BP]positive regulation of cellular biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0046983 [MF]protein dimerization activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0060393 [BP]regulation of pathway-restricted SMAD protein phosphorylationprobableGO:0042325, GO:0090092, GO:0010646, GO:0019220, GO:0080090, GO:0019222, GO:0051246, GO:0009966, GO:0031323, GO:0031399, GO:0048583, GO:0050794, GO:0051174, GO:0060255, GO:0032268, GO:0065007, GO:0023051, GO:0008150, GO:0001932, GO:0050789
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R52, chain A
Confidence level:very confident
Coverage over the Query: 310-391
View the alignment between query and template
View the model in PyMOL
Template: 3RJR, chain A
Confidence level:very confident
Coverage over the Query: 25-293,306-391
View the alignment between query and template
View the model in PyMOL