Diaphorina citri psyllid: psy16001

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32

MVDNSQTEIHLVPICSSQDIDLESQANSLDHFVPAFKLVDSTNGSNGFCLLGKDESSNSKGHQMKVYANLFDFLSSNSGIDHPLCEECTDTLLDMMDKELKNTKQDFQEYSDFLKTLELQLQYSLSQLNKFKSTNVFNATFHIWHSGHFGTINNFRLGTLPSAPVDWSEINAAWGQTALLLTALARKLNLTFQRYRIVPYGNHSYIEDTTEHKNLPLFASGGAKFFWDTKFDMAMVAFLDCLQQFKEELEKGDSEFHLPYNMDSKGKIEDETTGNTYSVKYQFNSQEQWTKALKFMLTNLKWGLAWVSSQFKNQFQDL

cccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEECccccEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccc

********IHLVPICSSQDIDLESQANSLDHFVPAFKLVDSTNGSNGFCLLG***********MKVYANLFDFLSSNSGIDHPLCEECTDTLLDMMDKELKNTKQDFQEYSDFLKTLELQLQYSLSQLNKFKSTNVFNATFHIWHSGHFGTINNFRLGTLPSAPVDWSEINAAWGQTALLLTALARKLNLTFQRYRIVPYGNHSYIEDTTEHKNLPLFASGGAKFFWDTKFDMAMVAFLDCLQQFKEELEKGDSEFHLPYNMDSKGKIEDETTGNTYSVKYQFNSQEQWTKALKFMLTNLKWGLAWVSSQF*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Beclin-1	Plays a central role in autophagy. Required for the abcission step in cytokinesis. May play a role in antiviral host defense.	confident	Q5R878
Beclin-1	Plays a central role in autophagy. Required for the abcission step in cytokinesis. May play a role in antiviral host defense.	confident	Q91XJ1
Beclin-1-like protein		confident	Q9VCE1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0060548 [BP]	negative regulation of cell death	probable	GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010941, GO:0050789, GO:0048523
GO:0008285 [BP]	negative regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0016023 [CC]	cytoplasmic membrane-bounded vesicle	probable	GO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0051707 [BP]	response to other organism	probable	GO:0008150, GO:0050896, GO:0009607, GO:0051704
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0006914 [BP]	autophagy	probable	GO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005802 [CC]	trans-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030425 [CC]	dendrite	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DDP, chain A
Confidence level:very confident
Coverage over the Query: 116-311
View the alignment between query and template
View the model in PyMOL

Template: 2P1L, chain B
Confidence level:probable
Coverage over the Query: 57-76
View the alignment between query and template
View the model in PyMOL