Diaphorina citri psyllid: psy16002


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MLETYKVLLHTLQDRPDDKAEMQLLLNNIDKLDKERASIGNTTVKLESYHVAISEAPKVPKSSSEARKMDLEMAVLMQELLSMREDKAELRARIYNLEHEKDVLEMKLNSLACEELTQHAGDTDDKSVENKLRERLKEMSQTLERVSRTYELRQMQSTQLTNELKMANNALMNSFEKGKKKSQSRLKRLENEIVIMSERHATQVQHLKQRIVSLEEHIARYNSKERNTS
cHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
**ETYKVLL**************LLLNNID********IGNTTVKLESYHVA*************************************LRARIYNLEHEKDVLEMKLNSLAC*******************************************************************************IVI********VQHLKQRIVSL***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLETYKVLLHTLQDRPDDKAEMQLLLNNIDKLDKERASIGNTTVKLESYHVAISEAPKVPKSSSEARKMDLExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELTQHAGDTDDKSVxxxxxxxxxxxxxxxxxxxxxYELRQMQSTQLTNELKMANNALxxxxxxxxxxxxxxxxxxxxxxxxxxxxHATQxxxxxxxxxxxxxxxxxxxxxERNTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031941 [CC]filamentous actinprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005884, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0030029 [BP]actin filament-based processprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0030016 [CC]myofibrilprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226
GO:0002102 [CC]podosomeprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030863 [CC]cortical cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0043226, GO:0044448

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 79-200
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 81-148
View the alignment between query and template
View the model in PyMOL