Diaphorina citri psyllid: psy16002

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23

MLETYKVLLHTLQDRPDDKAEMQLLLNNIDKLDKERASIGNTTVKLESYHVAISEAPKVPKSSSEARKMDLEMAVLMQELLSMREDKAELRARIYNLEHEKDVLEMKLNSLACEELTQHAGDTDDKSVENKLRERLKEMSQTLERVSRTYELRQMQSTQLTNELKMANNALMNSFEKGKKKSQSRLKRLENEIVIMSERHATQVQHLKQRIVSLEEHIARYNSKERNTS

cHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc

**ETYKVLL**************LLLNNID********IGNTTVKLESYHVA*************************************LRARIYNLEHEKDVLEMKLNSLAC*******************************************************************************IVI********VQHLKQRIVSL***************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLETYKVLLHTLQDRPDDKAEMQLLLNNIDKLDKERASIGNTTVKLESYHVAISEAPKVPKSSSEARKMDLExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELTQHAGDTDDKSVxxxxxxxxxxxxxxxxxxxxxYELRQMQSTQLTNELKMANNALxxxxxxxxxxxxxxxxxxxxxxxxxxxxHATQxxxxxxxxxxxxxxxxxxxxxERNTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031941 [CC]	filamentous actin	probable	GO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005884, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051015 [MF]	actin filament binding	probable	GO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0001725 [CC]	stress fiber	probable	GO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0006936 [BP]	muscle contraction	probable	GO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0030029 [BP]	actin filament-based process	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0030016 [CC]	myofibril	probable	GO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226
GO:0002102 [CC]	podosome	probable	GO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030863 [CC]	cortical cytoskeleton	probable	GO:0005856, GO:0005737, GO:0043228, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0043226, GO:0044448

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 79-200
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 81-148
View the alignment between query and template
View the model in PyMOL