Diaphorina citri psyllid: psy16005


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MSYSNKYIFATLPRTQRGQPIVLGGDPKGKNFLYTNGNSVIIRNIENPAISDIYTEHSCAVNVAKYSPSGFYIASGDISGKVRIWDTVNKEHILKNEFHPIGGPIKDIAWSPDNQRMISIVENGAKVSSLPIDYEPSSISLDHEHGLVAVGGADSKISIVENGAKVSSLPIDYEPSSISLDHEHGLVAVGGADSKVHIYELNNKSLSPKAELDHLGPVTDCSFSPSNEYLVASDAHRKVVLYRVPDFE
ccCEEcEEECcccccccccCEEEEEcccccEEEEEcccEEEEEEccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEccccCEEEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccccCEEEEcccccEEEEECccccEEEECccccEEEcccccccEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEccccc
*S*SNKYIFATLPRTQRGQPIVLGGDPKGKNFLYTNGNSVIIRNIENPAISDIYTEHSCAVNVAKYSPSGFYIASGDISGKVRIWDTVNKEHILKNEFHPIGGPIKDIAWSPDNQRMISIVENGAKVSSLPIDYEPSSISLDHEHGLVAVGGADSKISIVENGAKVSSLPIDYEPSSISLDHEHGLVAVGGADSKVHIYELNNKSLSPKAELDHLGPVTDCSFSPSNEYLVASDAHRKVVLYRVPDF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYSNKYIFATLPRTQRGQPIVLGGDPKGKNFLYTNGNSVIIRNIENPAISDIYTEHSCAVNVAKYSPSGFYIASGDISGKVRIWDTVNKEHILKNEFHPIGGPIKDIAWSPDNQRMISIVENGAKVSSLPIDYEPSSISLDHEHGLVAVGGADSKISIVENGAKVSSLPIDYEPSSISLDHEHGLVAVGGADSKVHIYELNNKSLSPKAELDHLGPVTDCSFSPSNEYLVASDAHRKVVLYRVPDFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein 1 Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins. Doesn't sever actin filaments alone, but caps the barbed ends of filaments severed by cofilin, which blocks annealing and depolymerization and allows more extensive severing by cofilin.confidentQ6DIF4
WD repeat-containing protein 1 Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins.confidentQ2KJH4
WD repeat-containing protein 1 Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins.confidentO88342

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0042641 [CC]actomyosinprobableGO:0005856, GO:0005575, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045214 [BP]sarcomere organizationprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0001891 [CC]phagocytic cupprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0060187 [CC]cell poleprobableGO:0005575, GO:0044464, GO:0005623
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0030043 [BP]actin filament fragmentationprobableGO:0006996, GO:0007015, GO:0032984, GO:0043624, GO:0007010, GO:0030029, GO:0071822, GO:0008150, GO:0043933, GO:0071840, GO:0009987, GO:0051261, GO:0030036, GO:0008154, GO:0044763, GO:0016043, GO:0022411, GO:0030042, GO:0043241, GO:0044699
GO:0035317 [BP]imaginal disc-derived wing hair organizationprobableGO:0048563, GO:0030030, GO:0060429, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0048569, GO:0048513, GO:0071840, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0009987, GO:0009888, GO:0035114, GO:0044763, GO:0048731, GO:0022008, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0008150, GO:0048736, GO:0048737
GO:0030864 [CC]cortical actin cytoskeletonprobableGO:0005856, GO:0005737, GO:0043228, GO:0015629, GO:0043232, GO:0030863, GO:0044444, GO:0071944, GO:0044422, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005938, GO:0005575, GO:0044424, GO:0044464, GO:0043226, GO:0044448
GO:0005884 [CC]actin filamentprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 2-247
View the alignment between query and template
View the model in PyMOL