Diaphorina citri psyllid: psy16017


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MPLFTRKPKKDDHLLDNNNVGEHKSKIYNGTKSPAPVTEDSKPKLIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPAEENR
ccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccCEEcccccHHHHHHHHHHHHcccccccc
*******************************************KLIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLFTRKPKKDDHLLDNNNVGEHKSKIYNGTKSPAPVTEDSKPKLIFHCQLAHGSPTGLISGFSNVRELYQKIAECYEFPAEENR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PDZ domain-containing protein GIPC1 May be involved in G protein-linked signaling.confidentO14908

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032435 [BP]negative regulation of proteasomal ubiquitin-dependent protein catabolic processprobableGO:0009894, GO:0009895, GO:0009892, GO:0080090, GO:0032434, GO:0031324, GO:0031323, GO:0042176, GO:0042177, GO:0050789, GO:0051248, GO:0010605, GO:0031329, GO:0051246, GO:0060255, GO:0065007, GO:1901799, GO:0048519, GO:0031330, GO:0061136, GO:0050794, GO:0030162, GO:0019222, GO:0032269, GO:0032268, GO:0008150, GO:0045861, GO:0048523
GO:0030511 [BP]positive regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0017015, GO:0090092, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003674 [MF]molecular_functionprobable
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0012506 [CC]vesicle membraneprobableGO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0031988, GO:0005575, GO:0012505, GO:0043227, GO:0043226, GO:0044422, GO:0031982
GO:0031647 [BP]regulation of protein stabilityprobableGO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0043198 [CC]dendritic shaftprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0043197 [CC]dendritic spineprobableGO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted