Diaphorina citri psyllid: psy16024

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------

MSIAFKLKFLYLTFGTQQAMERGCRDLDQRIELYLDGERVDLPPIESVVVLNIPSWASGVDLWKLGRGNRKSGNGDGSHILSTFRRLLNPLQVVDLADKSPEEALQWVSLMPSSGQTLILAAGGDGTAAWILNTIHNMKLDPAPSVGIIPLGTGNDLSRVLGWGKLYDRDTCSPFQILDNLTRSKVAHLDRWSVQIKSIRQLRLTRALKCRWMYNYLSIGVDAQVALDFHNTRESSLYIFSSRAFNKFLYLTFGTQQAMERGCRDLDQRIELYLDGERVDLPPIESVVVLNIPSWASGVDLWKLGRGQKSPFTLTS

cccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccCECcccccccEEEcccccccccccccccccccccccccccHHHHHHHHHHcccccEEEccccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHcccccccCEEEEEcccccHHHHHHccccccccccccHHHHHHHHHcccccccccccEEEHHHHHHHHHccccccEEcccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEccCEECcccCEEEEEEcccccccccccccccccccccccccc

MSIAFKLKFLYLTFGTQQAMERGCRDLDQRIELYLDGERVDLPPIESVVVLNIPSWASGVDLWKLGRGN*******GSHILSTFRRLLNPLQVVDLADKSPEEALQWVSLMPSSGQTLILAAGGDGTAAWILNTIHNMKLDPAPSVGIIPLGTGNDLSRVLGWGKLYDRDTCSPFQILDNLTRSKVAHLDRWSVQIKSIRQLRLTRALKCRWMYNYLSIGVDAQVALDFHNTRESSLYIFSSRAFNKFLYLTFGTQQAMERGCRDLDQRIELYLDGERVDLPPIESVVVLNIPSWASGVDLWK*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004143 [MF]	diacylglycerol kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0050789 [BP]	regulation of biological process	probable	GO:0008150, GO:0065007
GO:0044255 [BP]	cellular lipid metabolic process	probable	GO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016310 [BP]	phosphorylation	probable	GO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BON, chain A
Confidence level:very confident
Coverage over the Query: 62-195,209-225,244-315
View the alignment between query and template
View the model in PyMOL