Diaphorina citri psyllid: psy16029


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MGAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTLRRSERLSTRTRAV
cHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccCEECccccc
MGAYFRRRSTSTAPLLTPPNIRDMLDSYSV*************TVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTLRRSERLSTRTRAV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTLRRSERLSTRTRAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome P450 18a1 Probably involved in steroid hormones biosynthesis.confidentQ95078

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070989 [BP]oxidative demethylationprobableGO:0070988, GO:0044710, GO:0008150, GO:0008152, GO:0055114
GO:0016098 [BP]monoterpenoid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006721, GO:0006720, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255
GO:0009410 [BP]response to xenobiotic stimulusprobableGO:0042221, GO:0050896, GO:0008150
GO:0019369 [BP]arachidonic acid metabolic processprobableGO:0044238, GO:0006631, GO:0008152, GO:0006082, GO:0071704, GO:1901568, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0006690, GO:0008150, GO:0044237, GO:0043436, GO:0001676, GO:0044255, GO:0033559, GO:0044281, GO:0006629
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0020037 [MF]heme bindingprobableGO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0034875 [MF]caffeine oxidase activityprobableGO:0033695, GO:0003824, GO:0003674, GO:0016725, GO:0016491
GO:0009404 [BP]toxin metabolic processprobableGO:0044710, GO:0019748, GO:0009987, GO:0044237, GO:0008150, GO:0008152
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008395 [MF]steroid hydroxylase activityprobableGO:0003824, GO:0004497, GO:0003674, GO:0016491
GO:0008392 [MF]arachidonic acid epoxygenase activityprobableGO:0004497, GO:0016705, GO:0003824, GO:0003674, GO:0008391, GO:0016491
GO:0009804 [BP]coumarin metabolic processprobableGO:0044710, GO:0009987, GO:0019748, GO:0006725, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0009698, GO:1901360, GO:0046483
GO:0016712 [MF]oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygenprobableGO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:1901575 [BP]organic substance catabolic processprobableGO:0008150, GO:0071704, GO:0009056, GO:0008152
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0042738 [BP]exogenous drug catabolic processprobableGO:0042737, GO:0050896, GO:0009987, GO:0042493, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0042221, GO:0017144, GO:0009056
GO:0044249 [BP]cellular biosynthetic processprobableGO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PM0, chain A
Confidence level:very confident
Coverage over the Query: 3-158
View the alignment between query and template
View the model in PyMOL