Psyllid ID: psy16029

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MGAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTLRRSERLSTRTRAV
cHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccEEEEccccc
cHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHHHHccccccccEEcccccEEccccEEcccccEEEEc
mgayfrrrststaplltppnirdmldsysvrksrrprwktaattvhgknpiakCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELdtvvgrnrlptledmpflpyteATILETLRRSSVVALGTIhavtrvfppltlrrserlstrtrav
mgayfrrrststaplltppnirdmldsysvrksrrprwktaattvhgknpiakcKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRnrlptledmpflpYTEATILETLRRSSVVALgtihavtrvfppltlrrserlstrtrav
MGAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPltlrrserlstrtrAV
*************************************WKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTL*************
MGAYFRRRSTSTAPLLTPPNIRDMLDSYSV*****************KNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTLRRSERLSTRTRAV
**********STAPLLTPPNIRDMLDSYS**************TVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTLRRSE*********
MGAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTLRRSERLSTRTRAV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTRVFPPLTLRRSERLSTRTRAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
Q95078 538 Cytochrome P450 18a1 OS=D yes N/A 0.779 0.230 0.516 1e-28
P79761 528 Cytochrome P450 1A5 OS=Ga yes N/A 0.729 0.219 0.391 5e-18
P56591519 Cytochrome P450 1A1 OS=Ov N/A N/A 0.547 0.167 0.482 1e-17
P00184 524 Cytochrome P450 1A1 OS=Mu yes N/A 0.729 0.221 0.408 1e-17
O77810 516 Cytochrome P450 1A2 OS=Ca no N/A 0.566 0.174 0.455 2e-17
P00185 524 Cytochrome P450 1A1 OS=Ra yes N/A 0.547 0.166 0.471 3e-17
Q6GUR1512 Cytochrome P450 1A1 OS=Ma yes N/A 0.547 0.169 0.459 6e-17
P33616512 Cytochrome P450 1A1 OS=Ma N/A N/A 0.547 0.169 0.459 6e-17
P04798512 Cytochrome P450 1A1 OS=Ho yes N/A 0.547 0.169 0.471 7e-17
P56590 524 Cytochrome P450 1A1 OS=Ca yes N/A 0.729 0.221 0.4 7e-17
>sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 Back     alignment and function desciption
 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 81/124 (65%)

Query: 16  LTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQW 75
             P NIRD++D Y     +     T A    GKN   +  Q+I DLFS GMETIK TL W
Sbjct: 280 FDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLW 339

Query: 76  SLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIH 135
             V+M+  P   + VQDELD VVGR+RLPT+ED+ +LP TE+TILE++RRSS+V L T H
Sbjct: 340 INVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTH 399

Query: 136 AVTR 139
           + TR
Sbjct: 400 SPTR 403
Probably involved in steroid hormones biosynthesis.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 Back     alignment and function description
>sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 Back     alignment and function description
>sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 Back     alignment and function description
>sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 Back     alignment and function description
>sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 Back     alignment and function description
>sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 Back     alignment and function description
>sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 Back     alignment and function description
>sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 Back     alignment and function description
>sp|P56590|CP1A1_CANFA Cytochrome P450 1A1 OS=Canis familiaris GN=CYP1A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
242013517 523 cytochrome P-450, putative [Pediculus hu 0.861 0.261 0.546 7e-36
383857455 538 PREDICTED: cytochrome P450 18a1-like [Me 0.874 0.258 0.503 2e-33
345497696 527 PREDICTED: cytochrome P450 18a1 [Nasonia 0.874 0.263 0.489 3e-33
408724249 419 cytochrome P450 CYP18A1, partial [Laodel 0.874 0.331 0.525 6e-33
48097776 537 PREDICTED: cytochrome P450 18a1 [Apis me 0.874 0.258 0.496 7e-33
340723594 539 PREDICTED: cytochrome P450 18a1-like [Bo 0.874 0.257 0.489 1e-32
350426737 539 PREDICTED: cytochrome P450 18a1-like [Bo 0.874 0.257 0.489 1e-32
194363749 527 cytochrome P450 CYP18A1 [Tribolium casta 0.779 0.235 0.524 1e-31
380022639 539 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.874 0.257 0.482 2e-31
332016963 532 Cytochrome P450 18a1 [Acromyrmex echinat 0.849 0.253 0.489 6e-31
>gi|242013517|ref|XP_002427451.1| cytochrome P-450, putative [Pediculus humanus corporis] gi|212511837|gb|EEB14713.1| cytochrome P-450, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 97/139 (69%), Gaps = 2/139 (1%)

Query: 1   MGAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGD 60
           M A+F+           P  +RD++D+Y +        +   T   GK+   + +QIIGD
Sbjct: 262 MAAFFQETIDEHKKTFDPSVMRDVVDAYLMEIENAG--EKGKTLFEGKDHDRQVQQIIGD 319

Query: 61  LFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATIL 120
           LF+ GMET+K TLQW++VYM+H+P VAKAVQ+ELD VVGRNRLP LEDMPFLPYTE+T+L
Sbjct: 320 LFTAGMETVKTTLQWAVVYMLHHPEVAKAVQEELDQVVGRNRLPNLEDMPFLPYTESTLL 379

Query: 121 ETLRRSSVVALGTIHAVTR 139
           E LRRSS+V LGT HA TR
Sbjct: 380 EILRRSSIVPLGTTHATTR 398

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383857455|ref|XP_003704220.1| PREDICTED: cytochrome P450 18a1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345497696|ref|XP_001600798.2| PREDICTED: cytochrome P450 18a1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|408724249|gb|AFU86442.1| cytochrome P450 CYP18A1, partial [Laodelphax striatella] Back     alignment and taxonomy information
>gi|48097776|ref|XP_393885.1| PREDICTED: cytochrome P450 18a1 [Apis mellifera] Back     alignment and taxonomy information
>gi|340723594|ref|XP_003400174.1| PREDICTED: cytochrome P450 18a1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350426737|ref|XP_003494528.1| PREDICTED: cytochrome P450 18a1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|194363749|ref|NP_001123908.1| cytochrome P450 CYP18A1 [Tribolium castaneum] gi|270014221|gb|EFA10669.1| cytochrome P450 18A1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380022639|ref|XP_003695147.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 18a1-like [Apis florea] Back     alignment and taxonomy information
>gi|332016963|gb|EGI57772.1| Cytochrome P450 18a1 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
FB|FBgn0010383 538 Cyp18a1 "Cytochrome P450-18a1" 0.767 0.226 0.524 1.3e-26
ZFIN|ZDB-GENE-070730-1533 cyp2u1 "cytochrome P450, famil 0.817 0.243 0.383 2.1e-18
UNIPROTKB|P79761 528 CYP1A5 "Cytochrome P450 1A5" [ 0.729 0.219 0.391 5.2e-17
UNIPROTKB|A4F3V8175 CYP1A1 "Cytochrome P450 1A1" [ 0.547 0.497 0.471 6.7e-17
UNIPROTKB|A4F3V9157 CYP1A1 "Cytochrome P450 1A1" [ 0.547 0.554 0.471 6.7e-17
UNIPROTKB|F1MM10519 CYP1A1 "Uncharacterized protei 0.547 0.167 0.494 8.3e-17
UNIPROTKB|O77810 516 CYP1A2 "Cytochrome P450 1A2" [ 0.566 0.174 0.455 1e-16
MGI|MGI:88588 524 Cyp1a1 "cytochrome P450, famil 0.729 0.221 0.408 1.1e-16
UNIPROTKB|F1SJ26 516 CYP1A2 "Uncharacterized protei 0.547 0.168 0.459 2.2e-16
UNIPROTKB|P05177 515 CYP1A2 "Cytochrome P450 1A2" [ 0.566 0.174 0.433 2.8e-16
FB|FBgn0010383 Cyp18a1 "Cytochrome P450-18a1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 305 (112.4 bits), Expect = 1.3e-26, P = 1.3e-26
 Identities = 64/122 (52%), Positives = 81/122 (66%)

Query:    18 PPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSL 77
             P NIRD++D Y     +     T A    GKN   +  Q+I DLFS GMETIK TL W  
Sbjct:   282 PNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWIN 341

Query:    78 VYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAV 137
             V+M+  P   + VQDELD VVGR+RLPT+ED+ +LP TE+TILE++RRSS+V L T H+ 
Sbjct:   342 VFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSP 401

Query:   138 TR 139
             TR
Sbjct:   402 TR 403
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0006694 "steroid biosynthetic process" evidence=NAS
GO:0016020 "membrane" evidence=NAS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0046344 "ecdysteroid catabolic process" evidence=IMP
GO:0008395 "steroid hydroxylase activity" evidence=IDA
GO:0035074 "pupation" evidence=IMP
GO:0007552 "metamorphosis" evidence=IMP
GO:0035210 "prepupal development" evidence=IMP
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0007304 "chorion-containing eggshell formation" evidence=IMP
ZFIN|ZDB-GENE-070730-1 cyp2u1 "cytochrome P450, family 2, subfamily U, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P79761 CYP1A5 "Cytochrome P450 1A5" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A4F3V8 CYP1A1 "Cytochrome P450 1A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A4F3V9 CYP1A1 "Cytochrome P450 1A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM10 CYP1A1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O77810 CYP1A2 "Cytochrome P450 1A2" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
MGI|MGI:88588 Cyp1a1 "cytochrome P450, family 1, subfamily a, polypeptide 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SJ26 CYP1A2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P05177 CYP1A2 "Cytochrome P450 1A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q95078CP18A_DROME1, ., 1, 4, ., -, ., -0.51610.77980.2304yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
pfam00067461 pfam00067, p450, Cytochrome P450 3e-21
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 4e-14
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 6e-13
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-13
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-10
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-09
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 3e-08
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 3e-08
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 7e-08
PLN02936 489 PLN02936, PLN02936, epsilon-ring hydroxylase 8e-07
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-06
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-06
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 3e-06
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 5e-04
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 0.001
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 88.5 bits (220), Expect = 3e-21
 Identities = 31/85 (36%), Positives = 50/85 (58%)

Query: 55  KQIIGDLFSTGMETIKNTLQWSLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPY 114
           +  + +LF  G +T  +TL W+L  +  +P V + +++E+D V+G  R PT +D+  +PY
Sbjct: 263 RATVLELFFAGTDTTSSTLSWALYELAKHPEVQEKLREEIDEVIGDKRSPTYDDLQNMPY 322

Query: 115 TEATILETLRRSSVVALGTIHAVTR 139
            +A I ETLR   VV L     VT+
Sbjct: 323 LDAVIKETLRLHPVVPLLLPREVTK 347

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
KOG0156|consensus489 100.0
KOG0158|consensus499 99.97
PLN02971543 tryptophan N-hydroxylase 99.96
PLN03234499 cytochrome P450 83B1; Provisional 99.96
PTZ00404482 cytochrome P450; Provisional 99.96
PLN02394503 trans-cinnamate 4-monooxygenase 99.96
PLN02183516 ferulate 5-hydroxylase 99.96
PLN02290516 cytokinin trans-hydroxylase 99.95
PLN02500490 cytochrome P450 90B1 99.95
PLN02687517 flavonoid 3'-monooxygenase 99.95
PLN03112514 cytochrome P450 family protein; Provisional 99.95
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.95
PLN00168519 Cytochrome P450; Provisional 99.95
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.95
PLN02966502 cytochrome P450 83A1 99.95
PLN03018534 homomethionine N-hydroxylase 99.95
PLN02655466 ent-kaurene oxidase 99.95
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.95
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.94
PLN02774463 brassinosteroid-6-oxidase 99.94
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.94
PLN02738 633 carotene beta-ring hydroxylase 99.94
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.94
KOG0157|consensus497 99.93
PLN02302490 ent-kaurenoic acid oxidase 99.93
PLN02196463 abscisic acid 8'-hydroxylase 99.93
PLN02936489 epsilon-ring hydroxylase 99.93
KOG0159|consensus519 99.93
PLN02987472 Cytochrome P450, family 90, subfamily A 99.92
KOG0684|consensus486 99.91
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.89
PLN02648480 allene oxide synthase 99.83
>KOG0156|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-33  Score=219.13  Aligned_cols=148  Identities=26%  Similarity=0.407  Sum_probs=128.8

Q ss_pred             hHHHHHHHHhhccccCCCCcCcHHHHHHHHHhcCCCCCCCCcccCCccchhhHHHhHhhhhhccchhhHHHHHHHHHHHH
Q psy16029          2 GAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMM   81 (159)
Q Consensus         2 ~~~~~~~i~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~ag~~tt~~~l~~~~~~l~   81 (159)
                      ..|+.+.|++|++..+.+..+|++|.+|+.+++++.  .   .+++++    |...+.++++||+|||++|+.|++.+|+
T Consensus       244 ~~~~~~~i~eh~~~~~~~~~~D~vD~lL~~~~~~~~--~---~~t~~~----i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll  314 (489)
T KOG0156|consen  244 DEFLERIIDEHREKIGDEEGRDFVDALLKLMKEEKA--E---GLTDDH----LKALILDLFLAGTDTTATTLEWAMAELL  314 (489)
T ss_pred             HHHHHHHHHHHHhhhccCCCCcHHHHHHHhhccccc--C---CCCHHH----HHHHHHHHHhcccchHHHHHHHHHHHHH
Confidence            468888999987754112238999999999776443  1   188888    9999999999999999999999999999


Q ss_pred             hCcHHHHHHHHHHHHhhCCCCCCCCCCCCCChhHHHHHHHHhcccCCCcccccccc---------------cccCCchhh
Q psy16029         82 HYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAV---------------TRVFPPLTL  146 (159)
Q Consensus        82 ~~p~~~~~l~~E~~~~~~~~~~~~~~~~~~~p~~~a~i~E~lRl~p~~~~~~~r~~---------------~~~~~~~~~  146 (159)
                      +||++|+|+++|++++.|.++.++.+|+.++||++|+|+|++|++|++|+.+||.+               .+.++.|++
T Consensus       315 ~~Pev~~K~qeEId~vvG~~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai  394 (489)
T KOG0156|consen  315 NNPEVQKKLQEEIDEVVGKGRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAI  394 (489)
T ss_pred             hCHHHHHHHHHHHHHHhCCCCCCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhh
Confidence            99999999999999999988889999999999999999999999999998655554               555889999


Q ss_pred             ccCCCCcCCCCC
Q psy16029        147 RRSERLSTRTRA  158 (159)
Q Consensus       147 ~~d~~~~~~~~~  158 (159)
                      ||||++|+||+.
T Consensus       395 ~rDp~vw~dP~e  406 (489)
T KOG0156|consen  395 HRDPKVWEDPEE  406 (489)
T ss_pred             hcCCccCCCccc
Confidence            999999999963

>KOG0158|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 6e-18
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 7e-18
3pm0_A 507 Structural Characterization Of The Complex Between 1e-16
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 2e-15
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 1e-14
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-14
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-14
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-14
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-14
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-14
3qm4_A 479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-14
2f9q_A 479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-14
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 4e-14
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-14
3czh_A 481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 7e-14
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-13
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-13
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 1e-13
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 4e-13
3ibd_A 476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 2e-12
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 3e-12
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 6e-12
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-11
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-11
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 3e-11
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 7e-11
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 5e-09
2q9f_A 456 Crystal Structure Of Human Cytochrome P450 46a1 In 4e-04
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure 
Iteration: 1

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 4/120 (3%)
Query: 20  NIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVY 79
           +IRD+ DS       +   + A   +  +  I     I+ DLF  G +T+   + WSL+Y
Sbjct: 250 HIRDITDSLIEHCQEKQLDENANVQLSDEKII----NIVLDLFGAGFDTVTTAISWSLMY 305
Query: 80  MMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIHAVTR 139
           ++  P V + +Q+ELDTV+GR+R P L D   LPY EA ILET R SS V     H+ TR
Sbjct: 306 LVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTR 365
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-40
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 3e-39
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-39
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-39
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-38
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-38
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-38
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 5e-38
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 5e-38
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-37
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 7e-19
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-15
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-13
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-13
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 6e-13
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 6e-13
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 9e-13
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-12
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-12
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 3e-11
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 5e-11
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-10
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 8e-09
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-06
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
 Score =  141 bits (358), Expect = 1e-40
 Identities = 36/124 (29%), Positives = 54/124 (43%)

Query: 16  LTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQW 75
               +I +MLD+    K                         IGD+F  G+ET  + ++W
Sbjct: 236 FRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKW 295

Query: 76  SLVYMMHYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVALGTIH 135
           +L +++H P V K + +E+D  VG +R PT+ D   L   EATI E LR   V  +   H
Sbjct: 296 TLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPH 355

Query: 136 AVTR 139
               
Sbjct: 356 KANV 359
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.97
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.97
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.97
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.97
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.97
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.97
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.96
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.96
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.96
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.96
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.96
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.96
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.96
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.96
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.95
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.95
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.95
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.95
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.94
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.94
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.94
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.94
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.91
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.9
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.9
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.9
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.89
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.89
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.89
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.89
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.89
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.89
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.88
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.88
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.88
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.88
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.88
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.88
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.88
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.88
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.88
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.88
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.88
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.88
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.88
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.88
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.88
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.88
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.88
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.88
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.88
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.88
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.88
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.88
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.88
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.87
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.87
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.87
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.87
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.87
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.87
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.87
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.87
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.87
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.87
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.86
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.86
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.86
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.86
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.85
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.84
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.83
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.79
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.79
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.77
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.67
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.66
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
Probab=99.97  E-value=6.5e-31  Score=204.81  Aligned_cols=151  Identities=21%  Similarity=0.382  Sum_probs=127.5

Q ss_pred             hHHHHHHHHhhccccCCCCcCcHHHHHHHHHhcCCCCCCCCcccCCccchhhHHHhHhhhhhccchhhHHHHHHHHHHHH
Q psy16029          2 GAYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMM   81 (159)
Q Consensus         2 ~~~~~~~i~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~ag~~tt~~~l~~~~~~l~   81 (159)
                      .+++.+.|+++++..+.+.++|+++.++....+...  ..+..+++++    +...+..+++||+|||+++++|++++|+
T Consensus       224 ~~~~~~~i~~r~~~~~~~~~~d~l~~ll~~~~~~~~--~~~~~l~~~~----i~~~~~~~~~AG~dTta~~l~~~l~~L~  297 (477)
T 1r9o_A          224 KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKH--NQPSEFTIES----LENTAVDLFGAGTETTSTTLRYALLLLL  297 (477)
T ss_dssp             HHHHHHHHHHHHHTCCTTCCCSHHHHHHHHHHHHTT--SCSCSCCHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhccCCCCchHHHHHHHHHHHhhhc--cCCCCCCHHH----HHHHHHHHhhcccccHHHHHHHHHHHHH
Confidence            356777788877654444568999999976443221  2234578888    9999999999999999999999999999


Q ss_pred             hCcHHHHHHHHHHHHhhCCCCCCCCCCCCCChhHHHHHHHHhcccCCCcc---------------cccccccccCCchhh
Q psy16029         82 HYPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVAL---------------GTIHAVTRVFPPLTL  146 (159)
Q Consensus        82 ~~p~~~~~l~~E~~~~~~~~~~~~~~~~~~~p~~~a~i~E~lRl~p~~~~---------------~~~r~~~~~~~~~~~  146 (159)
                      +||++|+++++|++++++.++.++.+++.+|||+++||+|++|++|+++.               .||+|+.+.++.+++
T Consensus       298 ~~P~~~~kl~~Ei~~~~~~~~~~~~~~~~~lpyl~a~i~E~lRl~p~~~~~~~R~~~~d~~~~g~~Ip~Gt~V~~~~~~~  377 (477)
T 1r9o_A          298 KHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSV  377 (477)
T ss_dssp             HCHHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHTSSTTCSCEECSSCEEETTEEECTTCEEEECSHHH
T ss_pred             hCHHHHHHHHHHHHHhcCCCCCCChHhhccCcHHHHHHHHHHHhcCCCCCCCceeccCCccccceecCCCCEEEEecHHh
Confidence            99999999999999999877789999999999999999999999999885               466677778999999


Q ss_pred             ccCCCCcCCCCC
Q psy16029        147 RRSERLSTRTRA  158 (159)
Q Consensus       147 ~~d~~~~~~~~~  158 (159)
                      ||||++|+||+.
T Consensus       378 ~rd~~~~~dP~~  389 (477)
T 1r9o_A          378 LHDNKEFPNPEM  389 (477)
T ss_dssp             HTCTTTSSSTTS
T ss_pred             hCCcccCCCccc
Confidence            999999999863
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.95
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.95
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.94
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.93
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.93
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.89
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.89
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.75
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.67
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.67
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.67
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.65
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.65
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.63
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.62
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.58
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.51
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.5
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.46
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.36
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.3
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=4.1e-28  Score=185.18  Aligned_cols=150  Identities=21%  Similarity=0.387  Sum_probs=127.0

Q ss_pred             HHHHHHHHhhccccCCCCcCcHHHHHHHHHhcCCCCCCCCcccCCccchhhHHHhHhhhhhccchhhHHHHHHHHHHHHh
Q psy16029          3 AYFRRRSTSTAPLLTPPNIRDMLDSYSVRKSRRPRWKTAATTVHGKNPIAKCKQIIGDLFSTGMETIKNTLQWSLVYMMH   82 (159)
Q Consensus         3 ~~~~~~i~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~ag~~tt~~~l~~~~~~l~~   82 (159)
                      +++.+.+.++++....+...|.++.+.........  ..+..+++++    +.+.+..+++||+|||+.+++|++++|+.
T Consensus       217 ~~~~~~i~~~~~~~~~~~~~d~~~~~~~~~~~~~~--~~~~~~~~~~----i~~~~~~~~~Ag~dTTa~~l~~~l~~L~~  290 (467)
T d1r9oa_         217 SYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKH--NQPSEFTIES----LENTAVDLFGAGTETTSTTLRYALLLLLK  290 (467)
T ss_dssp             HHHHHHHHHHHHTCCTTCCCSHHHHHHHHHHHHTT--SCSCSCCHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhhccccchhhhhhhhhhhhhhhc--cCCcccchhH----HHHHHHHHHHcccccchhHHHHHHHHhhc
Confidence            45666777776666666667777766655444333  3344567777    99999999999999999999999999999


Q ss_pred             CcHHHHHHHHHHHHhhCCCCCCCCCCCCCChhHHHHHHHHhcccCCCcc---------------cccccccccCCchhhc
Q psy16029         83 YPAVAKAVQDELDTVVGRNRLPTLEDMPFLPYTEATILETLRRSSVVAL---------------GTIHAVTRVFPPLTLR  147 (159)
Q Consensus        83 ~p~~~~~l~~E~~~~~~~~~~~~~~~~~~~p~~~a~i~E~lRl~p~~~~---------------~~~r~~~~~~~~~~~~  147 (159)
                      ||++++++++|++++++.+..++..++.++||+++|++|++|++|+++.               .+|+|+.+.++.+.+|
T Consensus       291 ~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~l~yL~a~i~E~lRl~p~~~~~~r~~~~~~~~~~g~~ip~gt~v~~~~~~~~  370 (467)
T d1r9oa_         291 HPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVL  370 (467)
T ss_dssp             CHHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHTSSTTCSCEECSSCEEETTEEECTTCEEEECSHHHH
T ss_pred             CchHHHHHHhhhhhhcCCCCCCcHHHhhhhhhhhhhccccccccccCCcccccccccccccceeEEecCCccccchhhhc
Confidence            9999999999999999988899999999999999999999999999876               5777778889999999


Q ss_pred             cCCCCcCCCCC
Q psy16029        148 RSERLSTRTRA  158 (159)
Q Consensus       148 ~d~~~~~~~~~  158 (159)
                      ||+++|+||+.
T Consensus       371 ~d~~~~~dp~~  381 (467)
T d1r9oa_         371 HDNKEFPNPEM  381 (467)
T ss_dssp             TCTTTSSSTTS
T ss_pred             CCcccCcCcce
Confidence            99999999874
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure