Diaphorina citri psyllid: psy16054

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---

HAEPLRTKRQNEENGAASGDDEPSVEQLCEGRPPEEYFRLTIEGDCRDVVRCDQAGENGITRLAGVRCPNGLAFDIDRQTCDWKTNVKNCDLLESLKQISCPSGLAFDVDKQTCDWKAKVTNCNQLDRPRKVLPILKTDEPVCPEGKLSCGNGECIDKTLFCDDKPDCKDESDENACSVEQDPNRAPDCDPTQCALPDCFCSADGTRIPGGIEPNQVPQMITITFNGAVNVDNSDLYDEIFNGNRQNPNGCQIKGTFFVSHKYTNYASVQELHRKGHEISVFSLTHKDDPKYWSGGSYDDWLAEMAGGRLIIERFANISDGSVIGVRAPYLRVGGNKQFSMMTDQFFVYDASITASLGRVPIWPYTLYFRMPHKCNGNAHNCPSKSHPTWEMVMNELDRRDDPTFDESLPGCHMVDSCSNIQTGEQFGRLLRHNFNRHFSTNRAPLGLHFHASWLKSKKEFKDELIKFIEEMLDRNDVYFVTMLQVIQWMQNPTELTSLRDFQEWKEKCDVKGQPYCSLPNACPLTTRELPGETIRLFTCMECPNNYPWILDPTGDGFSAKRK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCCccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccEECccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHccccccccccccccEEEEEcccccHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccCECcccccccccccHHHHHHHcccEEEcccccccccccccccccccccccccccccccccccccccEEEEcEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccCECcccHHHHcccHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccc

*****RTKRQN**********EPSVEQLCEGRPPEEYFRLTIEGDCRDVVRCDQAGENGITRLAGVRCPNGLAFDIDRQTCDWKTNVKNCDLLESLKQISCPSGLAFDVDKQTCDWKAKVTNCNQLDRPRKVLPILKTDEPVCPEGKLSCGNGECIDKTLFCDDKPDCK**************NRAPDCDPTQCALPDCFCSADGTRIPGGIEPNQVPQMITITFNGAVNVDNSDLYDEIFNGNRQNPNGCQIKGTFFVSHKYTNYASVQELHRKGHEISVFSLTHKDDPKYWSGGSYDDWLAEMAGGRLIIERFANISDGSVIGVRAPYLRVGGNKQFSMMTDQFFVYDASITASLGRVPIWPYTLYFRMPHKCNGNAHNCPSKSHPTWEMVMNELDRRDDPTFDESLPGCHMVDSCSNIQTGEQFGRLLRHNFNRHFSTNRAPLGLHFHASWLKSKKEFKDELIKFIEEMLDRNDVYFVTMLQVIQWMQNPTELTSLRDFQEWKEKCDVKGQPYCSLPNACPLTTRELPGETIRLFTCMECPNNYPWILDP**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008061 [MF]	chitin binding	confident	GO:0097367, GO:0003674, GO:0005488
GO:0004099 [MF]	chitin deacetylase activity	confident	GO:0016787, GO:0019213, GO:0016810, GO:0016811, GO:0003824, GO:0003674
GO:0035001 [BP]	dorsal trunk growth, open tracheal system	confident	GO:0032502, GO:0007424, GO:0060560, GO:0040007, GO:0048589, GO:0060541, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0044707
GO:0060439 [BP]	trachea morphogenesis	confident	GO:0060541, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0060438, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0035159 [BP]	regulation of tube length, open tracheal system	confident	GO:0035150, GO:0035151, GO:0035152, GO:0032501, GO:0044707, GO:0007424, GO:0060541, GO:0048856, GO:0090066, GO:0032502, GO:0065007, GO:0048731, GO:0008150, GO:0065008, GO:0007275, GO:0044699
GO:0005737 [CC]	cytoplasm	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007632 [BP]	visual behavior	confident	GO:0009628, GO:0044702, GO:0044704, GO:0044707, GO:0019098, GO:0009314, GO:0050896, GO:0007610, GO:0022414, GO:0032501, GO:0009416, GO:0044708, GO:0008150, GO:0044699, GO:0000003
GO:0005041 [MF]	low-density lipoprotein receptor activity	probable	GO:0038024, GO:0003674, GO:0030228, GO:0004872
GO:0006030 [BP]	chitin metabolic process	probable	GO:1901564, GO:0006040, GO:1901135, GO:0043170, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0006022, GO:1901071
GO:0005975 [BP]	carbohydrate metabolic process	probable	GO:0044238, GO:0008150, GO:0008152, GO:0071704
GO:0005576 [CC]	extracellular region	probable	GO:0005575

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3M0C, chain C
Confidence level:very confident
Coverage over the Query: 197-216
View the alignment between query and template
View the model in PyMOL

Template: 3QBU, chain A
Confidence level:very confident
Coverage over the Query: 233-496
View the alignment between query and template
View the model in PyMOL

Template: 2W3Z, chain A
Confidence level:confident
Coverage over the Query: 213-352,363-369,398-403,416-483
View the alignment between query and template
View the model in PyMOL