Diaphorina citri psyllid: psy1606

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----

MLHCQHLSEKLEYGIETVAILSHSFLNPGGFIIPCRSAIVDLGLNQVDPGLSPDGARCGDGKTKRDTVSKHDEIRGPYNANIKSRYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEKLNIFIALVGVVVWTEYDEITLNVNGDITLTNFLSYRKDRLVLSHPNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSSSVSPTEWSSCSLEYLALSFDHGMDYCMRNKPKACA

ccEEEEEcccccEEEEEccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcHHHHHccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccccCECcccHHHHHHHHHHHHHHcccccccccEEEEEccccccccEEEcCCccccccccccEEEEECccccHHHHHHHHHHHHHcccccccccccccccccccCCccccccccccccccccHHHHHHHHcccccccccccccccc

MLHCQHLSEKLEYGIETVAILSHSFLNPGGFIIPCRSAIVDLGLNQVDPGLS**********************RGPYNANIKSRYLELVIVVDNRLYNLFNKNSKLVHRHCKDISNVINALYEKLNIFIALVGVVVWTEYDEITLNVNGDITLTNFLSYRKDRLVLSHPNDNAQLLTGMTFSDGVVGKALKGPICTYEFSGGVNVDHKNVVGLVATTVAHEMGHNLGMEHDTTECTCPSDRCIMAPSSSSVSPTEWSSCSLEYLALSFDHGMDYCMRNKPK***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0004222 [MF]	metalloendopeptidase activity	probable	GO:0016787, GO:0004175, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008237
GO:0042221 [BP]	response to chemical stimulus	probable	GO:0050896, GO:0008150
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0032270 [BP]	positive regulation of cellular protein metabolic process	probable	GO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031323, GO:0051247, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0051259 [BP]	protein oligomerization	probable	GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042730 [BP]	fibrinolysis	probable	GO:0032101, GO:0080134, GO:0051241, GO:0048583, GO:1900046, GO:0050789, GO:0008150, GO:0061041, GO:1900047, GO:0065007, GO:0051239, GO:0030193, GO:0048519, GO:0050818, GO:0050819, GO:0030195
GO:0044459 [CC]	plasma membrane part	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0005576 [CC]	extracellular region	probable	GO:0005575

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G5C, chain A
Confidence level:very confident
Coverage over the Query: 80-282
View the alignment between query and template
View the model in PyMOL