Diaphorina citri psyllid: psy16071

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MSRRKMSKEEIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ
ccccccccccccEEEEcccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEcccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHcccEEEEEEEcccccccccccccccccccccEEEEEEEccc
**********IDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRKMSKEEIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006584 [BP]catecholamine metabolic processprobableGO:0009987, GO:1901564, GO:0009712, GO:0006725, GO:0044237, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0018958, GO:1901360, GO:1901615
GO:0004060 [MF]arylamine N-acetyltransferase activityprobableGO:0008080, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FD5, chain A
Confidence level:very confident
Coverage over the Query: 10-224
View the alignment between query and template
View the model in PyMOL