Psyllid ID: psy16071


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MSRRKMSKEEIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ
ccccccccccccEEEEcccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEcccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHcccEEEEEEEcccccccccccccccccccccEEEEEEEccc
ccccccccccccEEEEccHHHHHHHHHHHHHHccccccHHHHcccccccccHHHHHHHHHHHHcccEEEEEEccccEEEEEEEccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHccccEEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEEHHHccccccccEEEccccccHHEEEEEEEcc
msrrkmskeeidyvypipedkynDVIEHLRynffadeplnkcvglcetgrghselELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLnlfsrydvtsifecrilsvdnnyrgrglANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRnhldsatglpmftppsphtSLKVMVKILQ
msrrkmskeeidyvypipedkynDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATglpmftppsphtsLKVMVKILQ
MSRRKMSKEEIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ
**********IDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATG*********************
************YVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ
*********EIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ
********EEIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRKMSKEEIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKILQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q94521275 Dopamine N-acetyltransfer no N/A 0.88 0.72 0.347 6e-25
>sp|Q94521|DNAT_DROME Dopamine N-acetyltransferase OS=Drosophila melanogaster GN=Dat PE=1 SV=1 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 111/207 (53%), Gaps = 9/207 (4%)

Query: 18  PEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQ 77
           PED    VI  L+  FF DEPLN  + L E      ELE +S+  L DN S  AVN  G+
Sbjct: 64  PEDG-EAVIAMLKTFFFKDEPLNTFLDLGEC----KELEKYSLKPLPDNCSYKAVNKKGE 118

Query: 78  VIGVALNGIQHEGDVDEAIKKL-ETLNDKKFKQIFSMLYDLNQSLNLFSRY-DVTSIFEC 135
           +IGV LNG+      D+  +K  ++    KFK+I S++  + +  N+F  Y D   I + 
Sbjct: 119 IIGVFLNGLMRRPSPDDVPEKAADSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDG 178

Query: 136 RILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEY 195
           +ILSVD NYRG G+A  L + + +   + G  V+ V  +  +S ++  KLG   +  +++
Sbjct: 179 KILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQF 238

Query: 196 RNHLDSATGLPMFTPPSPHTSLKVMVK 222
            ++     G  +F P +PH  ++VM K
Sbjct: 239 ADY--KPQGEVVFKPAAPHVGIQVMAK 263




Catalyzes N-acetylation of tryptamine, tyramine, dopamine, serotonin and octopamine. Is not essential for sclerotization.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 8EC: 7

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
48096775213 PREDICTED: hypothetical protein LOC41129 0.911 0.962 0.526 1e-56
340718970247 PREDICTED: hypothetical protein LOC10064 0.946 0.862 0.5 1e-55
156552355213 PREDICTED: hypothetical protein LOC10011 0.897 0.948 0.504 5e-55
383849059213 PREDICTED: uncharacterized protein LOC10 0.911 0.962 0.502 2e-54
307171461238 hypothetical protein EAG_03152 [Camponot 0.942 0.890 0.495 3e-54
300068971213 N-acetyltransferase 2 [Bombyx mori] gi|1 0.92 0.971 0.5 1e-50
322793124214 hypothetical protein SINV_02234 [Solenop 0.911 0.957 0.497 3e-50
158287451223 AGAP011168-PA [Anopheles gambiae str. PE 0.924 0.932 0.473 4e-50
157134049222 hypothetical protein AaeL_AAEL012952 [Ae 0.897 0.909 0.490 7e-50
170055059222 conserved hypothetical protein [Culex qu 0.92 0.932 0.492 6e-49
>gi|48096775|ref|XP_394768.1| PREDICTED: hypothetical protein LOC411294 isoform 1 [Apis mellifera] gi|380012679|ref|XP_003690405.1| PREDICTED: uncharacterized protein LOC100865767 [Apis florea] Back     alignment and taxonomy information
 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 111/211 (52%), Positives = 148/211 (70%), Gaps = 6/211 (2%)

Query: 14  VYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVN 73
           V  +PE++++D I HL++NFF+DEPLN  VGLCE G    ELE H +LTL+   S M VN
Sbjct: 8   VVDVPENRFDDAIHHLKWNFFSDEPLNHAVGLCEKGESQFELERHCLLTLKQGYSRMLVN 67

Query: 74  GNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIF 133
            NG + G+ALNGI  +G+ +EA ++L  LNDKKFK IF +LY +N+ ++LFS+Y+V  +F
Sbjct: 68  QNGMIAGMALNGILKKGEREEAERRLAELNDKKFKIIFGLLYKVNEKIDLFSKYNVDELF 127

Query: 134 ECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIEL 193
           ECRILS+D N+RG+GLAN L   SI+ A  AGFKVFK DATG+FSQK+  K G +   E+
Sbjct: 128 ECRILSIDENFRGKGLANILMADSIETARNAGFKVFKADATGMFSQKVCLKHGFQVEAEI 187

Query: 194 EYRNHLDSATGLPMFTPPSPHTSLKVMVKIL 224
            Y + LD +       P  PH +LK+MVKIL
Sbjct: 188 LYTD-LDES-----IRPTPPHEALKLMVKIL 212




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340718970|ref|XP_003397932.1| PREDICTED: hypothetical protein LOC100643699 [Bombus terrestris] Back     alignment and taxonomy information
>gi|156552355|ref|XP_001602063.1| PREDICTED: hypothetical protein LOC100117960 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383849059|ref|XP_003700164.1| PREDICTED: uncharacterized protein LOC100883873 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307171461|gb|EFN63305.1| hypothetical protein EAG_03152 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|300068971|ref|NP_001177771.1| N-acetyltransferase 2 [Bombyx mori] gi|197281735|gb|ACH57095.1| N-acetyltransferase 2 [Bombyx mori] Back     alignment and taxonomy information
>gi|322793124|gb|EFZ16818.1| hypothetical protein SINV_02234 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|158287451|ref|XP_309481.4| AGAP011168-PA [Anopheles gambiae str. PEST] gi|157019657|gb|EAA05105.4| AGAP011168-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157134049|ref|XP_001663122.1| hypothetical protein AaeL_AAEL012952 [Aedes aegypti] gi|392935727|pdb|4FD5|A Chain A, Crystal Structure Of Arylalkylamine N-Acetyltransferase 2 From Aedes Aegypti gi|392935728|pdb|4FD6|A Chain A, Crystal Structure Of Native Arylalkylamine N-Acetyltransferase 2 From The Yellow Fever Mosquito, Aedes Aegypti gi|108870618|gb|EAT34843.1| AAEL012952-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170055059|ref|XP_001863411.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167875155|gb|EDS38538.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
FB|FBgn0040376228 CG13759 [Drosophila melanogast 0.942 0.929 0.431 2.8e-41
FB|FBgn0019643275 Dat "Dopamine N acetyltransfer 0.88 0.72 0.347 5.2e-26
FB|FBgn0032839222 CG10659 [Drosophila melanogast 0.893 0.905 0.285 4e-19
FB|FBgn0034429224 CG18607 [Drosophila melanogast 0.906 0.910 0.260 4.6e-18
FB|FBgn0031791216 CG9486 [Drosophila melanogaste 0.871 0.907 0.262 3.9e-12
FB|FBgn0029813216 CG15766 [Drosophila melanogast 0.644 0.671 0.253 1.3e-11
FB|FBgn0040376 CG13759 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 438 (159.2 bits), Expect = 2.8e-41, P = 2.8e-41
 Identities = 94/218 (43%), Positives = 129/218 (59%)

Query:    11 IDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVM 70
             ++Y    PE     V+EHLR NFFADEPLNK  GLC+ G     LE H    +Q  +SVM
Sbjct:     1 MEYKMIAPEHS-EQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVM 59

Query:    71 AVNGNGQ----VIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSR 126
             AV+   +    ++GV LNGI   GD  +A+ KL+  +D  F++IF +L+  N   NLF  
Sbjct:    60 AVDAKEKDTLKIVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHRHNLKHNLFEH 119

Query:   127 YDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLG 186
             +DV  +F+ RILSVD+ YRG+G+ANEL K S+ +A K GF++ K DATG+FSQKI    G
Sbjct:   120 FDVDCMFDVRILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHG 179

Query:   187 LETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKIL 224
              E   E  Y  + D   G  +    +PH  L+ + K +
Sbjct:   180 FEVFSEQPYSKYTDE-NGKVILPVVAPHIKLQQLYKAI 216




GO:0008080 "N-acetyltransferase activity" evidence=ISS
FB|FBgn0019643 Dat "Dopamine N acetyltransferase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032839 CG10659 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034429 CG18607 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031791 CG9486 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0029813 CG15766 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
PTZ00330147 acetyltransferase; Provisional 99.75
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.75
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 99.74
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 99.72
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 99.71
KOG3139|consensus165 99.71
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 99.71
PRK03624140 putative acetyltransferase; Provisional 99.7
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 99.69
PHA00673154 acetyltransferase domain containing protein 99.69
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 99.68
KOG3216|consensus163 99.68
COG1247169 Sortase and related acyltransferases [Cell envelop 99.68
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 99.65
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 99.64
PRK07922169 N-acetylglutamate synthase; Validated 99.64
PRK10140162 putative acetyltransferase YhhY; Provisional 99.63
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 99.62
PRK10514145 putative acetyltransferase; Provisional 99.61
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 99.61
PRK07757152 acetyltransferase; Provisional 99.61
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.6
PLN02825515 amino-acid N-acetyltransferase 99.59
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 99.57
PRK09831147 putative acyltransferase; Provisional 99.57
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 99.57
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 99.56
COG3153171 Predicted acetyltransferase [General function pred 99.55
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 99.55
PRK10562145 putative acetyltransferase; Provisional 99.53
PRK05279441 N-acetylglutamate synthase; Validated 99.53
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.52
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 99.52
KOG3396|consensus150 99.5
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 99.5
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 99.5
COG0456177 RimI Acetyltransferases [General function predicti 99.49
PRK01346 411 hypothetical protein; Provisional 99.48
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 99.48
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 99.45
PRK15130186 spermidine N1-acetyltransferase; Provisional 99.44
PHA01807153 hypothetical protein 99.42
PRK10314153 putative acyltransferase; Provisional 99.42
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.42
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 99.4
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 99.34
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 99.33
PRK13688156 hypothetical protein; Provisional 99.33
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 99.31
KOG3235|consensus193 99.29
COG3393268 Predicted acetyltransferase [General function pred 99.23
KOG3234|consensus173 99.12
KOG3138|consensus187 99.1
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 99.09
KOG4144|consensus190 99.03
COG2153155 ElaA Predicted acyltransferase [General function p 99.0
COG3981174 Predicted acetyltransferase [General function pred 98.99
KOG3397|consensus225 98.91
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 98.89
KOG2488|consensus202 98.83
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 98.83
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 98.8
COG1670187 RimL Acetyltransferases, including N-acetylases of 98.66
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 98.59
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 98.58
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 98.51
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 98.37
COG3818167 Predicted acetyltransferase, GNAT superfamily [Gen 98.33
COG4552 389 Eis Predicted acetyltransferase involved in intrac 98.27
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 98.19
COG238899 Predicted acetyltransferase [General function pred 98.1
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 97.99
PF06852181 DUF1248: Protein of unknown function (DUF1248); In 97.87
COG3375266 Uncharacterized conserved protein [Function unknow 97.84
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 97.8
PF01233162 NMT: Myristoyl-CoA:protein N-myristoyltransferase, 97.79
KOG4135|consensus185 97.7
COG3053 352 CitC Citrate lyase synthetase [Energy production a 97.62
PF04958 342 AstA: Arginine N-succinyltransferase beta subunit; 97.08
PRK13834207 putative autoinducer synthesis protein; Provisiona 97.08
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 96.97
PF00765182 Autoind_synth: Autoinducer synthetase; InterPro: I 96.91
PRK10456 344 arginine succinyltransferase; Provisional 96.89
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 96.8
TIGR03243 335 arg_catab_AOST arginine and ornithine succinyltran 96.62
TIGR03245 336 arg_AOST_alph arginine/ornithine succinyltransfera 96.51
TIGR03244 336 arg_catab_AstA arginine N-succinyltransferase. In 96.5
TIGR03694241 exosort_acyl putative PEP-CTERM/exosortase system- 96.34
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 96.27
KOG2779|consensus 421 96.25
PF05301120 Mec-17: Touch receptor neuron protein Mec-17; Inte 96.15
COG5628143 Predicted acetyltransferase [General function pred 95.98
KOG2535|consensus554 95.94
PF09390161 DUF1999: Protein of unknown function (DUF1999); In 95.72
COG2401 593 ABC-type ATPase fused to a predicted acetyltransfe 95.65
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 95.35
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signa 95.19
TIGR03019330 pepcterm_femAB FemAB-related protein, PEP-CTERM sy 94.5
KOG3698|consensus891 93.78
PF04377128 ATE_C: Arginine-tRNA-protein transferase, C termin 93.75
COG5092 451 NMT1 N-myristoyl transferase [Lipid metabolism] 93.51
KOG4601|consensus264 92.8
PLN03238290 probable histone acetyltransferase MYST; Provision 92.44
COG3138 336 AstA Arginine/ornithine N-succinyltransferase beta 92.39
cd0426499 DUF619-NAGS DUF619 domain of various N-acetylgluta 92.28
cd0426599 DUF619-NAGS-U DUF619 domain of various N-acetylglu 92.23
PRK01305240 arginyl-tRNA-protein transferase; Provisional 92.13
PLN03239351 histone acetyltransferase; Provisional 91.39
PF13444101 Acetyltransf_5: Acetyltransferase (GNAT) domain 90.04
KOG2036|consensus 1011 89.99
PTZ00064552 histone acetyltransferase; Provisional 89.34
PRK14852 989 hypothetical protein; Provisional 88.46
PF12261179 T_hemolysin: Thermostable hemolysin; InterPro: IPR 87.68
TIGR03827 266 GNAT_ablB putative beta-lysine N-acetyltransferase 86.32
PLN00104450 MYST -like histone acetyltransferase; Provisional 86.3
PHA02769154 hypothetical protein; Provisional 85.33
PF04768170 DUF619: Protein of unknown function (DUF619); Inte 84.36
PF02474196 NodA: Nodulation protein A (NodA); InterPro: IPR00 84.12
KOG2747|consensus396 83.95
PF11124304 Pho86: Inorganic phosphate transporter Pho86; Inte 81.98
PF02799190 NMT_C: Myristoyl-CoA:protein N-myristoyltransferas 81.82
PF00925169 GTP_cyclohydro2: GTP cyclohydrolase II; InterPro: 81.34
COG5630495 ARG2 Acetylglutamate synthase [Amino acid transpor 80.42
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
Probab=99.75  E-value=1.8e-16  Score=114.56  Aligned_cols=134  Identities=19%  Similarity=0.138  Sum_probs=91.3

Q ss_pred             cceEEEecCCCCHHHHHHHHHhhccCCCcchhhccccCCCCCcHHHHHHHHHhcc-CC-eeEEEEecCCcEEEEEecccc
Q psy16071         10 EIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQ-DN-LSVMAVNGNGQVIGVALNGIQ   87 (225)
Q Consensus        10 ~~~~ir~~~~~D~~~i~~ll~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~-~~~va~~~~~~ivG~~~~~~~   87 (225)
                      .++.||+++++|.+++.+++..... ..+.           .......+...... .. ..+++.+.+|++||++.....
T Consensus         5 ~~~~ir~~~~~D~~~i~~l~~~~~~-~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~~~~~~~   72 (147)
T PTZ00330          5 GSLELRDLEEGDLGSVLELLSHLTS-APAL-----------SQEELEQIAARRRLAGVVTRVFVHSPTQRIVGTASLFVE   72 (147)
T ss_pred             ceEEEEEcccccHHHHHHHHHHhcC-CCcc-----------chhHHHHHHHHHhcCCCceEEEEEeCCCEEEEEEEEEec
Confidence            3689999999999999999876431 1111           11223333322111 22 223333445899999875321


Q ss_pred             cCCChhHHHHHHhhhCChhHHHHHHHHHHhhhccccccccCCCcEEEEEEEEEcCCcccCCHHHHHHHHHHHHHHHcCCc
Q psy16071         88 HEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFK  167 (225)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~l~~l~V~p~~rg~Gig~~L~~~~~~~a~~~g~~  167 (225)
                      .....                                   +.....++..++|+|+|||+|||++|++++++.|+++|+.
T Consensus        73 ~~~~~-----------------------------------~~~~~~~i~~~~V~~~~rg~Gig~~l~~~~~~~a~~~~~~  117 (147)
T PTZ00330         73 PKFTR-----------------------------------GGKCVGHIEDVVVDPSYRGQGLGRALISDLCEIARSSGCY  117 (147)
T ss_pred             ccccc-----------------------------------CCCceEEEEEEEECHHHcCCCHHHHHHHHHHHHHHHCCCC
Confidence            11000                                   1123467889999999999999999999999999999998


Q ss_pred             EEEEEecCHHHHHHHHHcCCeEEE
Q psy16071        168 VFKVDATGVFSQKISTKLGLETLI  191 (225)
Q Consensus       168 ~~~~~~~n~~~~~~y~k~Gf~~~~  191 (225)
                      .+.+. +|..+.+||+|+||+...
T Consensus       118 ~l~l~-~n~~a~~~y~k~GF~~~~  140 (147)
T PTZ00330        118 KVILD-CTEDMVAFYKKLGFRACE  140 (147)
T ss_pred             EEEEe-cChHHHHHHHHCCCEEec
Confidence            76544 689999999999998664



>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>KOG3139|consensus Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>KOG3216|consensus Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>KOG3396|consensus Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>KOG3235|consensus Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3234|consensus Back     alignment and domain information
>KOG3138|consensus Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>KOG4144|consensus Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3397|consensus Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>KOG2488|consensus Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans Back     alignment and domain information
>COG3375 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>KOG4135|consensus Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth Back     alignment and domain information
>PRK10456 arginine succinyltransferase; Provisional Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits Back     alignment and domain information
>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information
>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2779|consensus Back     alignment and domain information
>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG2535|consensus Back     alignment and domain information
>PF09390 DUF1999: Protein of unknown function (DUF1999); InterPro: IPR018987 This family contains a putative Fe-S binding reductase (Q72J89 from SWISSPROT) whose structure adopts an alpha and beta fold Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated Back     alignment and domain information
>KOG3698|consensus Back     alignment and domain information
>PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein Back     alignment and domain information
>COG5092 NMT1 N-myristoyl transferase [Lipid metabolism] Back     alignment and domain information
>KOG4601|consensus Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish Back     alignment and domain information
>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish Back     alignment and domain information
>PRK01305 arginyl-tRNA-protein transferase; Provisional Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain Back     alignment and domain information
>KOG2036|consensus Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PF12261 T_hemolysin: Thermostable hemolysin; InterPro: IPR022050 This family of proteins is found in bacteria Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PHA02769 hypothetical protein; Provisional Back     alignment and domain information
>PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 Back     alignment and domain information
>PF02474 NodA: Nodulation protein A (NodA); InterPro: IPR003484 Rhizobial nodulation (Nod) factors are signalling molecules secreted by root-nodulating rhizobia in response to flavanoids excreted by the host plant Back     alignment and domain information
>KOG2747|consensus Back     alignment and domain information
>PF11124 Pho86: Inorganic phosphate transporter Pho86; InterPro: IPR024297 Pho86p is an ER protein which is produced in response to phosphate starvation Back     alignment and domain information
>PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>PF00925 GTP_cyclohydro2: GTP cyclohydrolase II; InterPro: IPR000926 GTP cyclohydrolase II catalyses the first committed step in the biosynthesis of riboflavin Back     alignment and domain information
>COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
4fd5_A222 Crystal Structure Of Arylalkylamine N-Acetyltransfe 1e-52
3v8i_A210 Crystal Structure Of A Drosophila Melanogaster Dopa 4e-26
3te4_A215 Crystal Structure Of Dopamine N Acetyltransferase I 4e-26
4fd4_A217 Crystal Structure Of Mosquito Arylalkylamine N-Acet 7e-19
4fd7_A238 Crystal Structure Of Insect Putative Arylalkylamine 3e-16
3qb8_A197 Paramecium Chlorella Bursaria Virus1 Putative Orf A 2e-04
>pdb|4FD5|A Chain A, Crystal Structure Of Arylalkylamine N-Acetyltransferase 2 From Aedes Aegypti Length = 222 Back     alignment and structure

Iteration: 1

Score = 202 bits (514), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 100/204 (49%), Positives = 142/204 (69%), Gaps = 2/204 (0%) Query: 22 YNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGV 81 Y+DVIEHLR FFADEPLNK V L G+GH LE HS+ TL+DN+S+MA++ +G + GV Sbjct: 19 YDDVIEHLRQTFFADEPLNKAVNLTRPGQGHPLLEQHSLSTLKDNVSIMAISNDGDIAGV 78 Query: 82 ALNGIQH-EGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSV 140 ALNGI + D++++ +KL + D+ FK+IF +LY+ N +NLF ++DV IFE RILSV Sbjct: 79 ALNGILYGNTDIEKSREKLNEIQDESFKKIFKLLYEQNLKINLFKQFDVDKIFEIRILSV 138 Query: 141 DNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTKLGLETLIELEYRNHLD 200 D+ +RG+GLA +L + S ++A GF+V K DATG FSQ++ + LG T E+ Y ++LD Sbjct: 139 DSRFRGKGLAKKLIEKSEELALDRGFQVMKTDATGAFSQRVVSSLGFITKCEINYTDYLD 198 Query: 201 SATGLPMFTPPSPHTSLKVMVKIL 224 G +F PH LK+M K++ Sbjct: 199 E-NGEQIFVVDPPHEKLKIMCKVI 221
>pdb|3V8I|A Chain A, Crystal Structure Of A Drosophila Melanogaster Dopamine N- Acetyltransferase Length = 210 Back     alignment and structure
>pdb|3TE4|A Chain A, Crystal Structure Of Dopamine N Acetyltransferase In Complex With Acetyl-Coa From Drosophila Melanogaster Length = 215 Back     alignment and structure
>pdb|4FD4|A Chain A, Crystal Structure Of Mosquito Arylalkylamine N-Acetyltransferase Like 5b Length = 217 Back     alignment and structure
>pdb|4FD7|A Chain A, Crystal Structure Of Insect Putative Arylalkylamine N- Acetyltransferase 7 From The Yellow Fever Mosquito Aedes Aegypt Length = 238 Back     alignment and structure
>pdb|3QB8|A Chain A, Paramecium Chlorella Bursaria Virus1 Putative Orf A654l Is A Polyamine Acetyltransferase Length = 197 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 6e-52
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 7e-50
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 2e-49
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 1e-47
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 5e-41
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 4e-04
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Length = 217 Back     alignment and structure
 Score =  166 bits (421), Expect = 6e-52
 Identities = 60/220 (27%), Positives = 102/220 (46%), Gaps = 5/220 (2%)

Query: 6   MSKEEIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQD 65
           ++ E I        D+   V E L   ++ +E +              + E  S+  ++ 
Sbjct: 2   VAPESIVLR-VARLDELEQVREILHRIYYPEEGITIS--YVHGKSHTLDDERFSLSFVEQ 58

Query: 66  NLSVMAV-NGNGQVIGVALNGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLF 124
              V+A  +   + IGV++ G    GD D  +++  T   KK+  I  +L  L ++ ++ 
Sbjct: 59  GTVVVAEDSAAKKFIGVSIAGPIQPGDPDAMVEEAATTETKKWGDILKLLALLERTADVC 118

Query: 125 SRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKVFKVDATGVFSQKISTK 184
            RY +   +   IL+VD  YRG  L   L +  +D++ K GFK    D T VFS K++ K
Sbjct: 119 GRYGLEKAYHVHILAVDPTYRGHSLGQRLLQFQMDLSKKLGFKAISGDFTSVFSVKLAEK 178

Query: 185 LGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKIL 224
           LG+E + +L   ++ D   G  +F P   H  +K  VK+L
Sbjct: 179 LGMECISQLALGDYRDE-KGEKLFEPLDVHQVIKTCVKLL 217


>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Length = 222 Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} Length = 215 Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Length = 238 Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Length = 197 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 100.0
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 100.0
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 100.0
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 100.0
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 99.93
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.86
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.83
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.82
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.82
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 99.82
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.82
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 99.81
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 99.81
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 99.81
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.8
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 99.8
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 99.8
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 99.8
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.8
1tiq_A180 Protease synthase and sporulation negative regulat 99.79
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.79
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 99.79
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 99.79
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.79
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 99.79
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 99.79
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 99.79
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.78
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 99.78
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.78
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 99.78
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 99.77
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 99.77
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 99.77
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 99.77
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 99.77
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 99.77
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 99.77
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 99.76
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 99.76
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.76
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 99.76
3kkw_A182 Putative uncharacterized protein; acetyltransferas 99.76
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 99.76
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.76
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 99.75
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 99.75
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 99.75
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 99.75
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 99.75
1vkc_A158 Putative acetyl transferase; structural genomics, 99.75
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 99.75
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 99.75
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 99.75
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 99.75
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 99.74
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.74
2gan_A190 182AA long hypothetical protein; alpha-beta protei 99.74
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 99.74
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 99.74
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 99.74
2fe7_A166 Probable N-acetyltransferase; structural genomics, 99.74
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 99.73
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.73
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 99.73
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 99.73
2i6c_A160 Putative acetyltransferase; GNAT family, structura 99.73
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 99.73
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 99.73
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 99.73
3owc_A188 Probable acetyltransferase; structural genomics, P 99.73
1nsl_A184 Probable acetyltransferase; structural genomics, h 99.73
2eui_A153 Probable acetyltransferase; dimer, structural geno 99.73
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 99.72
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 99.72
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 99.72
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 99.72
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 99.72
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 99.72
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 99.72
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 99.72
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 99.71
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 99.71
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 99.71
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 99.71
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 99.71
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.71
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.71
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 99.71
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 99.71
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.71
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 99.71
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 99.71
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 99.71
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 99.7
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 99.7
3juw_A175 Probable GNAT-family acetyltransferase; structural 99.7
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 99.7
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 99.7
2aj6_A159 Hypothetical protein MW0638; structural genomics, 99.7
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 99.7
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 99.7
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 99.69
1y7r_A133 Hypothetical protein SA2161; structural genomics, 99.69
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 99.69
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 99.69
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 99.69
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 99.69
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 99.68
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 99.68
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 99.68
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 99.67
2fl4_A149 Spermine/spermidine acetyltransferase; structural 99.67
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 99.66
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.65
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 99.65
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 99.65
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 99.64
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 99.64
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 99.64
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 99.64
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 99.63
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 99.63
3frm_A254 Uncharacterized conserved protein; APC61048, staph 99.62
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.62
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 99.61
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 99.61
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 99.6
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 99.6
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 99.59
1z4r_A168 General control of amino acid synthesis protein 5- 99.59
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 99.59
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 99.59
2qml_A198 BH2621 protein; structural genomics, joint center 99.59
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 99.58
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 99.55
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.55
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 99.54
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 99.54
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 99.54
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 99.54
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 99.53
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 99.53
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 99.52
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.5
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 99.48
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; H 99.45
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 99.42
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 99.4
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 99.37
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 99.33
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.21
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 99.14
1xmt_A103 Putative acetyltransferase; structural genomics, p 98.9
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 98.81
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.54
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 98.52
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 98.49
1yle_A 342 Arginine N-succinyltransferase, alpha chain; struc 98.36
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 98.33
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 97.99
4b14_A 385 Glycylpeptide N-tetradecanoyltransferase; malaria, 97.54
1iyk_A 392 Myristoyl-COA:protein N-myristoyltransferase; HET: 97.38
1iic_A 422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 97.33
2wuu_A 421 N-myristoyltransferase; acyltransferase; HET: NHM; 97.31
3iu1_A 383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 97.3
1rxt_A 496 Myristoyl-, glycylpeptide N-tetradecanoyltransfera 96.98
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 96.02
4hkf_A191 Alpha-tubulin N-acetyltransferase; tubulin acetylt 95.84
4b5o_A200 Alpha-tubulin N-acetyltransferase; microtubules, c 95.64
4h6u_A200 Alpha-tubulin N-acetyltransferase; tubulin acetylt 95.58
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 95.54
4gs4_A240 Alpha-tubulin N-acetyltransferase; acetyl coenzyme 95.06
3gkr_A336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 94.49
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 94.11
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 93.93
2ou2_A280 Histone acetyltransferase htatip; structural genom 93.86
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 93.84
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 93.78
1iic_A422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 84.62
1lrz_A426 FEMA, factor essential for expression of methicill 80.67
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
Probab=100.00  E-value=7.7e-37  Score=234.99  Aligned_cols=214  Identities=47%  Similarity=0.800  Sum_probs=190.1

Q ss_pred             cceEEEecCCCCHHHHHHHHHhhccCCCcchhhccccCCCCCcHHHHHHHHHhccCCeeEEEEecCCcEEEEEeccccc-
Q psy16071         10 EIDYVYPIPEDKYNDVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILTLQDNLSVMAVNGNGQVIGVALNGIQH-   88 (225)
Q Consensus        10 ~~~~ir~~~~~D~~~i~~ll~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~va~~~~~~ivG~~~~~~~~-   88 (225)
                      +.++||+++++|++++.+++.++|..++|+....+....+.....+..++...+.++.++++++.+|+|||++++..+. 
T Consensus         7 ~~~~iR~a~~~D~~~i~~l~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~va~~~~g~ivG~~~~~~~~~   86 (222)
T 4fd5_A            7 NNIRFETISSKYYDDVIEHLRQTFFADEPLNKAVNLTRPGQGHPLLEQHSLSTLKDNVSIMAISNDGDIAGVALNGILYG   86 (222)
T ss_dssp             CCCEEEECCGGGHHHHHHHHHHHTTTTSHHHHHTTCCCTTTCCHHHHHHHHHHHTTSCCEEEECTTSCEEEEEEEEEEET
T ss_pred             CCEEEEECCHHHHHHHHHHHHHhcCCCCccchhhcccCCCcccHHHHHHHHHHHhCCcEEEEEeCCCCEEEEEEeccccC
Confidence            3789999999999999999999999999988766555444456677778888888899999998679999999988776 


Q ss_pred             CCChhHHHHHHhhhCChhHHHHHHHHHHhhhccccccccCCCcEEEEEEEEEcCCcccCCHHHHHHHHHHHHHHHcCCcE
Q psy16071         89 EGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASKAGFKV  168 (225)
Q Consensus        89 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~l~~l~V~p~~rg~Gig~~L~~~~~~~a~~~g~~~  168 (225)
                      +.+....++.......+.|+.++.++..+....+.+..++....+++..++|+|+|||+|||++|++++++.+++.|+..
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~i~~~~v~~~~rg~Gig~~l~~~~~~~~~~~g~~~  166 (222)
T 4fd5_A           87 NTDIEKSREKLNEIQDESFKKIFKLLYEQNLKINLFKQFDVDKIFEIRILSVDSRFRGKGLAKKLIEKSEELALDRGFQV  166 (222)
T ss_dssp             TSCTTHHHHHHHHCCCHHHHHHHHHHHHHHTTCCHHHHHTCSEEEEEEEEEECGGGTTSSHHHHHHHHHHHHHHHTTCCE
T ss_pred             CccHHHHHHHHhhccChhHHHHHHHHHHHHhhcchhhhcCCCcEEEEEEEEECHHHcCCCHHHHHHHHHHHHHHHCCCCE
Confidence            66655555555667888999999999999998888888887889999999999999999999999999999999999998


Q ss_pred             EEEEecCHHHHHHHHHcCCeEEEEEecccccccCCCcccCCCCCCCceEEEEEeec
Q psy16071        169 FKVDATGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKIL  224 (225)
Q Consensus       169 ~~~~~~n~~~~~~y~k~Gf~~~~~~~~~~~~~~~~g~~~f~~~~~~~~~~~~~~~~  224 (225)
                      +.+.++|..+++||+|+||+.++++++.+|.+ .+|+++|.+++||+++++|+|++
T Consensus       167 ~~~~~~~~~~~~~y~~~Gf~~~~~~~~~~~~~-~~g~~~f~~~~~~~~~~~~~k~l  221 (222)
T 4fd5_A          167 MKTDATGAFSQRVVSSLGFITKCEINYTDYLD-ENGEQIFVVDPPHEKLKIMCKVI  221 (222)
T ss_dssp             EEEEECSHHHHHHHHHTTCEEEEEEEGGGCBC-TTSSBSCCCCTTCCEEEEEEEEC
T ss_pred             EEEEeCCHHHHHHHHHCCCEEEEEEchhhhhc-cCCCEEeeCCCCCceEEEEEEec
Confidence            88889999999999999999999999999998 89999999999999999999987



>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* Back     alignment and structure
>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* Back     alignment and structure
>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.86
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 99.86
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.85
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 99.85
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.85
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 99.85
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 99.84
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.83
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 99.83
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.83
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.82
d1tiqa_173 Protease synthase and sporulation negative regulat 99.82
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 99.81
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.81
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 99.8
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.8
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 99.8
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 99.79
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 99.79
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 99.79
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.79
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 99.77
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.77
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 99.77
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 99.76
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 99.76
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.75
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 99.75
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 99.75
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 99.74
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.73
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.73
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 99.73
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 99.72
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 99.71
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.7
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 99.69
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 99.66
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis 99.65
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.65
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.63
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus fa 99.62
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 99.61
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 99.6
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 99.6
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 99.56
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 99.56
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 99.56
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 99.54
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 99.52
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.48
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 99.45
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 99.42
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 99.41
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 99.28
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 99.16
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosi 98.79
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 98.3
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 98.27
d1iyka1165 N-myristoyl transferase, NMT {Yeast (Candida albic 98.01
d1rxta1141 N-myristoyl transferase, NMT {Human (Homo sapiens) 97.99
d1iica1185 N-myristoyl transferase, NMT {Baker's yeast (Sacch 97.95
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 97.6
d1ylea1 338 Arginine N-succinyltransferase, alpha chain, AstA 97.34
d1lrza3182 Methicillin resistance protein FemA {Staphylococcu 97.14
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 95.63
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [T 95.55
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 94.6
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 94.46
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 94.31
d1iyka2227 N-myristoyl transferase, NMT {Yeast (Candida albic 89.36
d1iica2237 N-myristoyl transferase, NMT {Baker's yeast (Sacch 87.98
d2hqya1164 Hypothetical protein BT3689 {Bacteroides thetaiota 87.1
d1vp8a_190 Hypothetical protein AF0103 {Archaeoglobus fulgidu 81.34
d2d4pa1130 Hypothetical protein TTHA1254 {Thermus thermophilu 80.19
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Tabtoxin resistance protein
species: Pseudomonas syringae [TaxId: 317]
Probab=99.86  E-value=1.7e-20  Score=136.29  Aligned_cols=159  Identities=16%  Similarity=0.160  Sum_probs=108.5

Q ss_pred             EEEecCCCCHH----HHHHHHHhhccCCCcchhhccccCCCCCcHHHHHHHHHh---c-cCCee-EEEEecCCcEEEEEe
Q psy16071         13 YVYPIPEDKYN----DVIEHLRYNFFADEPLNKCVGLCETGRGHSELELHSILT---L-QDNLS-VMAVNGNGQVIGVAL   83 (225)
Q Consensus        13 ~ir~~~~~D~~----~i~~ll~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~-~~~~~-~va~~~~~~ivG~~~   83 (225)
                      .||.++++|++    ++.+++.+++.....    .+... +........+++..   + ..+.. +++.+ +|+|||++.
T Consensus         2 ~iR~~~~ed~~~~~~~l~~ll~d~~~~g~~----~g~~~-p~~~~~~~~~~~~~~~~~~~~~~~~~v~~~-~~~ivG~~~   75 (170)
T d1ghea_           2 QLRRVTAESFAHYRHGLAQLLFETVHGGAS----VGFMA-DLDMQQAYAWCDGLKADIAAGSLLLWVVAE-DDNVLASAQ   75 (170)
T ss_dssp             EEEECCTTTHHHHHHHHHHHHHHHHHTTCC----SSCCT-TCCHHHHHHHHHTTHHHHHHTSEEEEEEEE-TTEEEEEEE
T ss_pred             ceEECCHHHHHHHHHHHHHHHHHHHhcCCc----cccCC-CCCHHHHHHHHHHHHHHHhCCCcEEEEEEE-CCEEEEEEE
Confidence            48999999995    777777776532211    11111 11334445555432   2 23433 44544 699999987


Q ss_pred             cccccCCChhHHHHHHhhhCChhHHHHHHHHHHhhhccccccccCCCcEEEEEEEEEcCCcccCCHHHHHHHHHHHHHHH
Q psy16071         84 NGIQHEGDVDEAIKKLETLNDKKFKQIFSMLYDLNQSLNLFSRYDVTSIFECRILSVDNNYRGRGLANELFKLSIDIASK  163 (225)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~l~~l~V~p~~rg~Gig~~L~~~~~~~a~~  163 (225)
                      +......                                     ......++..++|+|+|||+|||++|++++++.|++
T Consensus        76 ~~~~~~~-------------------------------------~~~~~~~i~~l~V~p~~rg~GiG~~Ll~~~~~~a~~  118 (170)
T d1ghea_          76 LSLCQKP-------------------------------------NGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVAVK  118 (170)
T ss_dssp             EEECCST-------------------------------------TCTTEEEEEEEEECGGGTTSSHHHHHHHHHHHHHHH
T ss_pred             Eeecccc-------------------------------------CCCcEEEEEEEEEcchhhcCCcHHHHHHHHHHHHHH
Confidence            5322111                                     012346899999999999999999999999999999


Q ss_pred             cCCcEEEEEe-cCHHHHHHHHHcCCeEEEEEecccccccCCCcccCCCCCCCceEEEEEeec
Q psy16071        164 AGFKVFKVDA-TGVFSQKISTKLGLETLIELEYRNHLDSATGLPMFTPPSPHTSLKVMVKIL  224 (225)
Q Consensus       164 ~g~~~~~~~~-~n~~~~~~y~k~Gf~~~~~~~~~~~~~~~~g~~~f~~~~~~~~~~~~~~~~  224 (225)
                      +|+..+.+++ +|+.+.+||+|+||+.+++++-... + .+|+.        ++..+|+|.|
T Consensus       119 ~g~~~l~L~~~~n~~a~~fY~k~GF~~~g~~~~y~~-~-~~g~~--------~d~~~~~k~L  170 (170)
T d1ghea_         119 HKRGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCA-T-PDGRL--------HPTAIYFKTL  170 (170)
T ss_dssp             TTCCEEEEEEETTSHHHHHHHHTTCEEEEEEEEEEE-C-TTSCE--------EEEEEEEEEC
T ss_pred             cCCceEeeecccchHHHHHHHHCCCEEEEEeCCceE-C-CCCCE--------EEEEEEEEEC
Confidence            9999877654 6788999999999999998765332 2 34433        4677888875



>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hqya1 d.108.1.4 (A:135-298) Hypothetical protein BT3689 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1vp8a_ c.49.1.2 (A:) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure